Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Serdang D6 25 kDa coat protein, 18 kDa protein, 13 kDa protein, 20 kDa protein, and 23 kDa protein genes, complete cds.

ACC No: FJ190074

Dated: 2008-10-14 | Length: 3124 | CRC: 131917684

                
ID   FJ190074; SV 1; linear; genomic RNA; STD; VRL; 3124 BP.
XX
AC   FJ190074; EU523134; EU530634;
XX
DT   14-OCT-2008 (Rel. 97, Created)
DT   14-OCT-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Serdang D6 25 kDa coat protein, 18 kDa
DE   protein, 13 kDa protein, 20 kDa protein, and 23 kDa protein genes, complete
DE   cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-3124
RA   Razean Haireen M.R., Habibuddin H., Nuradni H.;
RT   "An Assessment on the Prevalence of Citrus Tristeza Virus Infection in an
RT   Orchard Farm at Serdang Selangor, Malaysia";
RL   Unpublished.
XX
RN   [2]
RP   1-3124
RA   Razean Haireen M.R., Habibuddin H.;
RT   ;
RL   Submitted (27-FEB-2008) to the EMBL/GenBank/DDBJ databases.
RL   Strategic Resource Research Centre, Malaysian Agricultural Research and
RL   Development Institute, P.O. Box 12301, Pejabat Besar Pos, Kuala Lumpur,
RL   Selangor 50774, Malaysia
XX
RN   [3]
RP   1-3124
RA   Razean Haireen M.R., Habibuddin H., Nuradni H.;
RT   ;
RL   Submitted (29-FEB-2008) to the EMBL/GenBank/DDBJ databases.
RL   Strategic Resource Research Centre, Malaysian Agricultural Research and
RL   Development Institute, P.O. Box 12301, Pejabat Besar Pos, Kuala Lumpur,
RL   Selangor 50774, Malaysia
XX
RN   [4]
RC   Sequence update by submitter
RP   1-3124
RA   Razean Haireen M.R., Habibuddin H., Nuradni H.;
RT   ;
RL   Submitted (08-SEP-2008) to the EMBL/GenBank/DDBJ databases.
RL   Strategic Resource Research Centre, Malaysian Agricultural Research and
RL   Development Institute, P.O. Box 12301, Pejabat Besar Pos, Kuala Lumpur,
RL   Selangor 50774, Malaysia
XX
CC   On or before Oct 13, 2008 this sequence version replaced
CC   gi:170522700, gi:169870318.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3124
FT                   /organism="Citrus tristeza virus"
FT                   /specific_host="Citrus hystrix"
FT                   /isolate="Serdang D6"
FT                   /mol_type="genomic RNA"
FT                   /country="Malaysia"
FT                   /collection_date="13-Jun-2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="25 kDa coat protein"
FT                   /protein_id="ACB20638.1"
FT                   /translation="MDDETKKLKNKNKETKEVDDVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGMT
FT                   YTREGVEVELSDKLWTDVVFNFKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFNT
FT                   R"
FT   CDS             638. .1141
FT                   /codon_start=1
FT                   /product="18 kDa protein"
FT                   /note="p18"
FT                   /protein_id="ACA96934.1"
FT                   /translation="MSGSLGNLTHVDLLRSESRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLENMNPLAYLLKLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVILGTNVDDSRCGCSIWFYNNGTYQNGLIRCNNLVAL
FT                   FSTT"
FT   CDS             1175. .1534
FT                   /codon_start=1
FT                   /product="13 kDa protein"
FT                   /note="p13"
FT                   /protein_id="ACI40922.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRVVVIPLSGSTANESRADRANISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCGN"
FT   CDS             1610. .2158
FT                   /codon_start=1
FT                   /product="20 kDa protein"
FT                   /note="p20"
FT                   /protein_id="ACI40923.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPGVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEARLRVLLDVIRRRFTREKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKVVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
FT   CDS             2240. .2869
FT                   /codon_start=1
FT                   /product="23 kDa protein"
FT                   /note="p23"
FT                   /protein_id="ACI40924.1"
FT                   /translation="MDNTSGQIFVSVNLSDESNTASTEVKTVSSEADRLEFLQKLNPFI
FT                   IDALIRKTSYQGARFRARIIGVCVDCGRKHNKGLKNERKCKVNNTQSQNEVAHMLLHDP
FT                   VKYLKKGKARAFSNAEMFAIDLVMYTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGATAEAISPDINAVDVGDNEDTSSEYPVSLSVSGGVPREHHFI"
FT   3'UTR           2870. .3124
XX
SQ   Sequence 3124 BP; 869 A; 583 C; 753 G; 919 T; 0 other;

fj190074 Length: 3124  14-OCT-2008  Type: N  Check: 6602  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  agtcgacgat gttgttgcag ctgaatcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttgggtacc
     151  caacagaacg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ctttcactta gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtatga cgtacactcg ggaaggtgtt gaagtggaat tatctgacaa
     351  actttggaca gacgtcgtgt ttaactttaa gggtattggt aaccgtacaa
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagacgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaagtcata gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt gatctgttgc gttccgaatc ccggtttctg
     701  tcgggatggt ggagtttcat cgttaacgta ggtgatataa tcgtccggtt
     751  tgcgttacac gttcctaatg aagatatgct gaatagcttt tcagctatat
     801  cgaattgtac gatcattgca gatggtagtg ctttactaaa agacaatacc
     851  gtggttgatc gtttagaaaa catgaatcct ttggcttatt tgttaaaatt
     901  agcgaaaacg actactacta tttgttttac catgtctaat aaggttcttt
     951  ttggtactac taaatccgaa ccacttagtt gtttagctat cacgtcagat
    1001  cgagttctat tcaaagttat tttgggtact aacgttgatg attctcgatg
    1051  cggctgcagt atttggtttt acaacaacgg tacctatcaa aacggtttga
    1101  tccgttgtaa taatctcgtc gctttgttta gcacgactta gacacgaagt
    1151  ggccgttagg atttaattgc tgcaatgagt attcgacgtg tgtggttaaa
    1201  ggttgtggct gtaatcacgg tattatggta cggtaaggaa ccttctatta
    1251  gtgaaggtta caacgctctt atgaatgatg actttaagtt tatcgacacg
    1301  catttttcaa acgtttctta tgctaagaaa tgttacgatt tggctaattt
    1351  cgatttagac tttctacgcg tcgttgtcat tcctttaagt ggtagtacgg
    1401  cgaatgaatc gcgtgctgat cgcgctaata tttcagaaat tgtcgaatcg
    1451  catgtaagcg accgagacag aatgaacatt ttgttgcgta acaagcggat
    1501  ccaaatccca tcgctcttac cttgcggtaa ctagagtcta ctcagtagta
    1551  cgtctactag tataacgtac tgaacacttt agtaaaggat tttgttcgaa
    1601  ctaaacaata tgcgagctta ctttagtgtt aacgattaca taagcctttt
    1651  ggctaaggtt ggcgcagtcg tggaacgttt gtgcgatccc ggcgtaactc
    1701  tcacggaagt gatggacgaa attaatgact ttaactcgtt cctcgctttg
    1751  gtgcactcta tgaagtcaga catgaatgga gaccatcagg atggtcacca
    1801  tgagatgggt gaacacaagt ctcggttgtt atgcaacata gaggcgagat
    1851  tgcgagtgct tctcgacgtc ataagacgtc ggtttactcg cgaaaagctg
    1901  ctctgtacca gcgcgacaga tgtcatgggc ttctttgtta tgaggtacat
    1951  gagttccagc cacaccagct tcgagtcagt aatgagaacg gagttgaagt
    2001  tagtagttaa ggtggtactg tcggatttgt cccgcacgca taaactggat
    2051  tttagcgagc gagcttttgc ggcttatggt atccttttgc aaaagggtac
    2101  tgtgtcgacc gtttgcggtc agtttgatat taatttagtc tctccgtctt
    2151  gtgtgtaggt taatacgttt ctcagaacgt gtagttgtat taactaactt
    2201  taattcgaac aagcttattg taaaagtctg cgagttacga tggataatac
    2251  tagcggacaa attttcgttt ctgtgaacct ttccgacgaa agtaacacag
    2301  cgagtactga agttaaaacc gtaagttcgg aagcggatcg cttggaattt
    2351  ttacaaaaat taaatccctt tattatcgac gctttgatac ggaaaaccag
    2401  ttatcagggt gctcgctttc gcgccagaat aataggagtg tgcgtggatt
    2451  gtggtagaaa acacaacaag gggttgaaaa acgaacgtaa gtgtaaggtc
    2501  aacaatacac agtctcagaa cgaggtggcg catatgttat tgcacgatcc
    2551  cgttaagtat ttaaagaaag gaaaggctag agccttttct aacgcagaga
    2601  tgtttgcgat cgatttggtt atgtacacca aggaaaggca attggcggtt
    2651  gatttagccg ctgaaaggga gaagacgaga ctggctcgta gacacccaat
    2701  gcgttctccg gaagaaactc cggaacatta taaattcggt gcgactgctg
    2751  aggcaatttc gccggacatc aacgccgtag acgttggtga taacgaggac
    2801  acttcgtcgg agtacccagt gagtctgagt gtatctggcg gagttccccg
    2851  tgaacaccac ttcatctgat tgaagtggac ggaataagtt ctttacggaa
    2901  ctttatgtcg ggttggtaaa aacccttatg atggtgatat atcactagac
    2951  aataaccgga tgggtaaagt ctttaaaatg atcgagggga aaattaaccg
    3001  tatcctctcg ttggtctaag ctcccacaga gtggtagtgg tctcaagtga
    3051  ggcttaacgt atgcgtgaac caaagaagtt ctccttagag tgtgtgttgt
    3101  ttacccaacg cactgtccct atgg