Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Keawwhan Mandarin 69 coat protein (p25) gene, partial cds.

ACC No: FJ429963

Dated: 2008-12-16 | Length: 666 | CRC: 2106780500

                
ID   FJ429963; SV 1; linear; genomic RNA; STD; VRL; 666 BP.
XX
AC   FJ429963;
XX
DT   16-DEC-2008 (Rel. 98, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate Keawwhan Mandarin 69 coat protein (p25) gene,
DE   partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-666
RA   Paradornuwat A., Kositratana W., Chowpongpang S.;
RT   "Cloning and sequencing of Citrus tristeza closterovirus coat protein
RT   gene";
RL   Thai J. Agric. Sci. 37:99-108(2004).
XX
RN   [2]
RP   1-666
RA   Paradornuwat A., Kositratana W., Chowpongpang S.;
RT   ;
RL   Submitted (31-OCT-2008) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, Kasetsart University, Phahonyotin, Jatujak, Bangkok 10900,
RL   Thailand
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .666
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="Keawwhan Mandarin 69"
FT                   /serotype="Rangsit"
FT                   /mol_type="genomic RNA"
FT                   /country="Thailand"
FT                   /PCR_primers="fwd_name: CTV-Bam, fwd_seq:
FT                   ggattcgacgaaacaaagaaattgaag, rev_name: CTV-Hind, rev_seq:
FT                   aagctttcaacgtgtgttgaatttc"
FT                   /db_xref="taxon:12162"
FT   gene            <1. .666
FT                   /gene="p25"
FT   CDS             <1. .666
FT                   /codon_start=1
FT                   /gene="p25"
FT                   /product="coat protein"
FT                   /protein_id="ACJ49210.1"
FT                   /translation="DETKKLKNKNKETKEGDDVVAAESSFGSVNLHIDPTLIAMNDVRQ
FT                   LGTQRNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGMTYT
FT                   REGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRPLD
FT                   AGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVIVTNVRQLGKFNTR"
XX
SQ   Sequence 666 BP; 197 A; 124 C; 166 G; 179 T; 0 other;

fj429963 Length: 666  16-DEC-2008  Type: N  Check: 4064  ..

       1  gacgaaacaa agaaattgaa gaacaaaaac aaggaaacga aagaaggtga
      51  cgatgttgtt gcggctgagt cttcttttgg ttccgtaaac ttacacatcg
     101  atccgactct gatagcgatg aacgatgtgc gtcagttggg tacccaacgg
     151  aatgctgctt tgaatagaga tttgtttctt accttgaaag ggaagtatcc
     201  taacttacct gacaaagata aagactttca catagctatg atgttatatc
     251  gtttagcagt taagagctca tcattacaaa gcgacgatga taccacgggt
     301  atgacgtaca ctcgggaagg tgttgaagtg gaattgtctg acaaactttg
     351  gacagacgtc gtgtttaact ctaagggtat tggtaaccgt actaacgccc
     401  ttcgagtctg gggtagatct aacgatgccc tttatttggc tttttgtaga
     451  cagaaccgca acttgagtta cggtggacgt ccgttagacg caggaattcc
     501  agccgggtat cactacctgt gtgcagattt cttgaccgga gccggcttga
     551  ctgatttaga atgtgctgtg tacatacaag ctaaagagca attattaaag
     601  aagcgagggg ctgatgaagt catagttact aatgtcaggc agcttgggaa
     651  attcaacaca cgttga