Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone Y8 coat protein gene, partial cds.

ACC No: FJ446482

Dated: 2008-12-29 | Length: 672 | CRC: 1908658495

                
ID   FJ446482; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ446482;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   29-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone Y8 coat protein gene, partial cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Liu Y., Zhou C., Cao M.;
RT   "Preliminary characterization of CTV isolates from Hubei, China";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Liu Y., Zhou C., Cao M.;
RT   ;
RL   Submitted (06-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   National Citrus Virus Exclusion Center, Citrus Research Institute of
RL   Chinese Academy of Agriculture Science, No.15 Citrus Village, Beibei,
RL   Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="grapefruit"
FT                   /mol_type="genomic RNA"
FT                   /country="China:Enshi, Hubei"
FT                   /collection_date="20-Sep-2008"
FT                   /clone="Y8"
FT                   /note="PCR_primers=fwd_name: CTV-CP1, rev_name: CTV-CP3"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .>672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACJ86379.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSMNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLALKGKHPNLPDKDKDFHIAMVLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVDVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNCNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   TL"
XX
SQ   Sequence 672 BP; 195 A; 131 C; 168 G; 178 T; 0 other;

fj446482 Length: 672  29-DEC-2008  Type: N  Check: 235  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgac gttgttgctg ctgagtcttc tttcggttcc atgaacttac
     101  acatcgatcc aactctgata acgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttgctt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcacata gctatggtgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga tgacgacact
     301  acaggtataa cgtacactcg ggagggtgtt gacgtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaga attgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacaccacgt ta