Sequence of DPV Soybean yellow mottle mosaic virus

Soybean yellow mottle mosaic virus strain HB10 coat protein (CP) gene, complete cds.

ACC No: FJ494848

Dated: 2008-12-24 | Length: 1068 | CRC: -921877101

                
ID   FJ494848; SV 1; linear; genomic RNA; STD; VRL; 1068 BP.
XX
AC   FJ494848;
XX
DT   24-DEC-2008 (Rel. 98, Created)
DT   24-DEC-2008 (Rel. 98, Last updated, Version 1)
XX
DE   Soybean yellow mottle mosaic virus strain HB10 coat protein (CP) gene,
DE   complete cds.
XX
KW   .
XX
OS   Soybean yellow mottle mosaic virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-1068
RA   Park S.J., Kim S.M., Nam M., Lee T.S., Kim Y.J., Moon J.K., Kim C.S.,
RA   Choi H.S., Moon J.S., Kim H.G., Lee S.H.;
RT   ;
RL   Submitted (20-NOV-2008) to the EMBL/GenBank/DDBJ databases.
RL   Agricultural Microbiology Division, National Academy of Agricultural
RL   Science, RDA, Suin-ro, 150, Suwon, Gyeongi-do 441-707, Korea
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1068
FT                   /organism="Soybean yellow mottle mosaic virus"
FT                   /host="Glycine max"
FT                   /strain="HB10"
FT                   /mol_type="genomic RNA"
FT                   /country="South Korea"
FT                   /collection_date="13-Sep-2006"
FT                   /db_xref="taxon:578361"
FT   gene            1. .1068
FT                   /gene="CP"
FT   CDS             1. .1068
FT                   /codon_start=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="ACK77386.1"
FT                   /translation="MNGKMLTIAQLAKKEKTEGRRAXSKNQRKRLDSADTRPLKEVSST
FT                   ARVSTRRVPAAISSNVSNGVPNYAVRQNKPVIQHTELWGTLMSNSTESPAYIAPRTLNP
FT                   SDPATFNWVQPLSTGYNMYRLINCEIIYTPRGATTTEGSVSLAHDPDASDANPDNVTDL
FT                   LNMAGAVSGSVFSPLRIKPNIKQLDRYVRDNSTSDPKLVDAGKILVAAYGQQASTTPFA
FT                   LGEVRFSYTLQLLNPQPHSTMVQRLGAAPPPGVGPTYATLRTVNGPTTSSNVLTFSTAG
FT                   AYLITAVDATAGLGTPVTTDFGRFRVQGTSAADSPLLMFGTALKSGATITFSGPVSNVL
FT                   DVYVVRDSGVSDNSS"
XX
SQ   Sequence 1068 BP; 257 A; 314 C; 249 G; 247 T; 1 other;

fj494848 Length: 1068  24-DEC-2008  Type: N  Check: 2525  ..

       1  atgaatggaa aaatgctcac cattgcccaa ctcgccaaga aggagaaaac
      51  agagggacga agagctkttt ccaagaacca gcgaaagcga ctcgactccg
     101  ctgacactcg gcccctcaag gaagtcagta gcaccgctag agtgtcaaca
     151  cgaagagtcc ccgctgccat ctcgtccaat gtgtccaatg gagtaccgaa
     201  ctacgctgtt cgacaaaaca aaccggtcat tcagcatact gagctatggg
     251  gaactcttat gtctaatagc actgagtccc ctgcttatat cgctcctcgg
     301  acactcaacc caagtgatcc tgcaacattc aattgggtgc aaccgctctc
     351  cacagggtat aatatgtaca gactcattaa ttgtgagatc atctacactc
     401  ccaggggtgc gactaccact gagggatcgg tgtctttggc gcatgatcca
     451  gacgctagtg atgctaaccc tgataatgtc actgacctgc ttaacatggc
     501  tggcgctgtc tctggctcgg tcttctctcc cctcaggatc aagccaaaca
     551  ttaaacagct cgaccgttat gttcgtgaca attctactag cgaccccaag
     601  ctggttgatg ctggcaagat attggttgca gcatatgggc agcaagcttc
     651  aacaaccccc ttcgcccttg gcgaagtgag gttttcatac acgctccagc
     701  tgctcaaccc tcagccacat tcaactatgg tgcaacgact cggggctgcc
     751  ccaccccctg gggtgggccc cacttacgca accttgcgta cagttaatgg
     801  tcccaccaca tccagcaatg ttctcacatt ttcgactgct ggcgcctacc
     851  ttattactgc cgttgacgca acagctgggc tcggaacccc ggtcaccact
     901  gatttcggcc ggttccgcgt acagggcact agtgctgcgg actccccact
     951  actgatgttc ggaacagccc tcaagagtgg ggctaccatt accttcagtg
    1001  ggcctgtctc caacgttttg gatgtttatg ttgtgcgcga tagcggagtt
    1051  agcgacaact ctagctag