Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate NZRB-M12, complete genome.

ACC No: FJ525431

Dated: 2010-04-07 | Length: 19255 | CRC: 71916318

                
ID   FJ525431; SV 1; linear; genomic RNA; STD; VRL; 19255 BP.
XX
AC   FJ525431;
XX
DT   08-FEB-2009 (Rel. 99, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate NZRB-M12, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19255
RX   PUBMED; 20352212.
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   "Isolates of Citrus tristeza virus that overcome Poncirus trifoliata
RT   resistance comprise a novel strain";
RL   Arch. Virol. 155(4):471-480(2010).
XX
RN   [2]
RP   1-19255
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   ;
RL   Submitted (04-DEC-2008) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland 0630, New Zealand
XX
DR   RFAM; RF00193; CTV_rep_sig.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19255
FT                   /organism="Citrus tristeza virus"
FT                   /host="Poncirus trifoliata"
FT                   /isolate="NZRB-M12"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /collection_date="03-Jul-2005"
FT                   /note="resistance-breaking genotype: RB"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9458
FT                   /codon_start=1
FT                   /product="p349 protein"
FT                   /db_xref="GOA:B9VB08"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="InterPro:IPR022054"
FT                   /db_xref="InterPro:IPR022108"
FT                   /db_xref="InterPro:IPR022239"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB08"
FT                   /protein_id="ACM49850.1"
FT                   /translation="MSKLRGSFWSSAFAASSDYTISRIWRELNTIIVLHYFGSVRITKV
FT                   IRDKSADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGNPVINASGVVSPR
FT                   SVAGFSRFSLCKPPLSSAAKKSIRQAKRESVSPFSRASSLFSREVPRGTRSKLRRRVVR
FT                   RIDTTLPESPQDKPIRQNRRLGKTSQLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIA
FT                   FGTMSATAWCSKSDAAVLRCRLNYHAAETDFSTQEKHVRYVYNDVSSAANRPRTVSSRK
FT                   CGSVFPSKSKLGVEVPSGRDHHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVFMSDGVNTARLDVVAPAYYAYAKSLGAKARFLWESSDLDDTKI
FT                   RDGQCYVRHVFDVALYFGRRADFSVRRALGLYPTVGAFKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTESSVDLRSIPNHHLVGGTSAHVLIGQIRINVPGSTTKPSRSAVRRRNR
FT                   RMRRDGYLGSSGSSSSTGESNYCSDCSSPRSMPSPSILKPSLGRVPSIDQRFRFPAGTQ
FT                   LRVSVPRRVDDYVYVSTGQNFDELCHAVCTYVKRYNSRKSFYTRFESGGDYVVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYESRYAATMTDVGTSWVPKGYVPDAEIVKRRRSRNRR
FT                   PPLSRRVVDQSVPALPSSPVEVTSASSDRSSSSEKASTASFDSVKSSDWVNVGSSRRTT
FT                   TDVRESCLTGRGKIGNFPFPRGTVYNTSVDERAYKRVLKLRDCTVCSFLRILLARLSSY
FT                   RPLSDDFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIGSGS
FT                   LLGLDAYGFSESLKEGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPHIFEVQHRLERLYG
FT                   KAASRYGVRGYYSAPRYFHCCHDDSPKPSTSFNKYHKMGGEDNSLIITDTDRLRAVGSA
FT                   YEKVKRNIPDSLLIRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSGNQQVMLTRAYPEF
FT                   NINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCRPVY
FT                   DVKDAHRRVVRHHQLNKVSLDQSDGVKQVGAVNTNSVCGNVLGECYHESEAIVMVQVYD
FT                   VPLHELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQVVYCFNN
FT                   SAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCVTKSSVCPRISETKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGE
FT                   TSIFELVKFAISEKCRDLFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLIISEYSELD
FT                   VPINLPGFGRIADGDETRLMEDGIKSALLRKAVRDEAQLNLKRGNTSEIVPCEDDDNSN
FT                   GDDSRVSHDSDGGSSSGGSSGGLRAGAAPSLFRCVLRKLGGGLCLAKKVLELLLKQVVE
FT                   SFSRLKRKTTRLTSFANLLLARLSCRFSDDSVFSAVWEIAVNLTRIVNGVVKTKLECFR
FT                   NLFRLIPKLYVGCRDVVKDVSNAYRSAVLFSAEIFGKSYSKLCQFCLETFDVGLIEISA
FT                   RNLGLETCVSMAQAIFDVLVAFPLGSVSFPVVCARVFGALAMEVGSNFLFKKVFGKPET
FT                   LGEDAFRRAVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEADAWVGYSK
FT                   HEVSSLPIVTFCVKKLSYSLERCKEECITFVVDSAKKILKSLTSEFNESIQNSDLTSGA
FT                   KSLYGHVSSILSTSSGVINKAGNAVATVKAVGSDIGGRVKRLRPRFSLSRHFDEQTSEY
FT                   YSASDCSELDESLLSETPGLRGNGKCRDLFRIISRRTVACSEYLINLLKRLTSRATEYS
FT                   YSYVMDLLVRLYVATDDVVRRCRSFTLDCTDRASNFIVGCLSWYNLRSGAYSATPGLGG
FT                   GSRSLTTVFPTGGFVRVIEALGNVLSVVFDEEFFRTLLHRLRTDVVVLLVEFLKNLPVC
FT                   LFSVYTFFECRGRVFPLREFLWGFCRFVWEIVEGLSINVYQHLSAVVVKAYRCAFNRQF
FT                   SEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEMSLSRSSDSPSFPPTYGEIVEL
FT                   NDDSSDSALVIGVDDGTGRAIVDSETDSASGSDSDVSIPLDRDFEQIGGLGGNGNVDVF
FT                   RLGLRFTLKLLRNLFNARSFKVLYGLLLQTLFYGGSVNKFVSRLAFSLGTCLPFELFRF
FT                   ACSARRSFKSLASFVYQTNLFSEATVEHLFSFSRLLYDSRYFSSVFSEVERFDFYLDHF
FT                   LSLPKRYLFPNSKVRGRARAPVLVTRTEQVTPVRKRSLNDILDSLDSLKVSDLKGKSTF
FT                   VDDGESDSGSERSGSSISFGSINEEVLNAVNGDGVCEKAPLMKHATALSKLEPDPSGRK
FT                   DIPVSKKTFTRGECSGVKSKAGMCDYLVTLNSSFGTVPDMYPVARDVTFKKLTNAMREF
FT                   YYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGSHPF
FT                   RSTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNEEHS
FT                   LIVYEAPPGGGKTHSLVNCYADYCNKVSCLVVTANKNSQTEISQRISSELMSRKRAAKY
FT                   VTSAASRVFTVDSYLMNHLRLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSKQ
FT                   IHYIHRNDLGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICEWLSEFYPRHVATANVGSI
FT                   GKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRTKVVPIVNTVHEV
FT                   QGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNIGRAK
FT                   EIFDKFRSTSHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGSSVVQLG
FT                   DVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVATRKPSVV
FT                   RKS"
FT   CDS             <9382. .10815
FT                   /codon_start=1
FT                   /product="RdRp protein"
FT                   /note="start codon not determined; likely expressed by +1
FT                   ribosomal frameshift"
FT                   /db_xref="GOA:B9VB09"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB09"
FT                   /protein_id="ACM49851.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPSDFGRAM
FT                   AAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIKAVQAELKLPFSVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPCFDEFKNRVLSSLNDNIV
FT                   FFTEMTNAGLAEVVRRIIGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDTEL
FT                   LDVWMEGEYRARAATLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQNKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVEAKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERVVHDNRVGYFSYFD
FT                   NPFTKPDASDGQMDDLMTN"
FT   CDS             10864. .11775
FT                   /codon_start=1
FT                   /product="p33 protein"
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB10"
FT                   /protein_id="ACM49852.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYVKT
FT                   VDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENL
FT                   NKVCSSSFSFRAVSETAINELSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRGANLG
FT                   DSSGVQSRTIEEEGYRTDTAGDIAVTIPNTPLVSAVSPYVAEYNENTRSRISLVRRVCC
FT                   YAVCVLVVSLLIMSGLLTIIFI"
FT   CDS             11845. .12000
FT                   /codon_start=1
FT                   /product="p6 protein"
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProtKB/TrEMBL:O10470"
FT                   /protein_id="ACM49853.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12006. .13790
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /db_xref="GOA:B9VB12"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB12"
FT                   /protein_id="ACM49854.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGAKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTDVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELAEFLPQKELNVSSLKEALSLQTDPVKYTVTNYG
FT                   ISGTVSIDQTTLREIASVFITRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYSECLDGRSKALLIDCVTHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRNCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTRVDSMGKVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13714. .15321
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB13"
FT                   /protein_id="ACM49855.1"
FT                   /translation="MSSHHVWGSLFQKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVEFTGMPLKSLMTGIEDRKVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSIEIDAYKTIVFT
FT                   KNFDSSISGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRLFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLECVVESDALDDLSQHVDIRLAADNPN
FT                   LRVDLRWAGMFVYYGVYRCAIDRAVERPTLFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPAHHSYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMGRD
FT                   VATSGFNLPYHGRSYNTS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB14"
FT                   /protein_id="ACM49856.1"
FT                   /translation="MAGHTILPKTDDKEMDPVSAAVPGKYPDVVEKFVANRSVDALIEG
FT                   VISKLDTSSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16112. .16783
FT                   /codon_start=1
FT                   /product="p25 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB15"
FT                   /protein_id="ACM49857.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDATGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFST
FT                   R"
FT   CDS             16749. .17252
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB16"
FT                   /protein_id="ACM49858.1"
FT                   /translation="MSGSLGNLAHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLNLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYDNGTFQNGLIRCNNLVAL
FT                   FSAT"
FT   CDS             17286. .17645
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB17"
FT                   /protein_id="ACM49859.1"
FT                   /translation="MSFRRLWLKVIAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRANHANVSEIVESHISDRDRMSILL
FT                   RNKRIQIPSLLPCGD"
FT   CDS             17721. .18269
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /db_xref="InterPro:IPR021742"
FT                   /db_xref="UniProtKB/TrEMBL:Q1X8W8"
FT                   /protein_id="ACM49860.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   AVATVCSQFDINLVSPSCV"
FT   CDS             18352. .18981
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB19"
FT                   /protein_id="ACM49861.1"
FT                   /translation="MNDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPVI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLHTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPELNAVGVGDNEDTSSEYPVSLSVSGGVLREHHFV"
FT   3'UTR           18982. .19255
XX
SQ   Sequence 19255 BP; 4720 A; 3812 C; 4813 G; 5910 T; 0 other;

fj525431 Length: 19255  07-APR-2010  Type: N  Check: 426  ..

       1  aatttcacaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gctttcgctg
     151  ctagcagcga ttacacgatc tcgcgcatct ggcgcgaact taacaccata
     201  atagtcctgc actattttgg ttctgttaga atcaccaagg tgattcgtga
     251  caaatcggcc gatatgccga tagtccctct acggaaatct gtatttccgt
     301  tctctgttcg cgcggctgtt cgcgcaattc gtgccgctgg gcgtcctctc
     351  gacgctccgc attctgggtg cctctgtggc aatcccgtta tcaacgcatc
     401  tggcgttgtt agtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc cctctcctcc gccgctaaga agtccattcg tcaggcaaag
     501  cgggaatctg tttccccttt tagccgggct tcttctctct tctctaggga
     551  agtccctcgc ggcacacgtt ctaaacttcg aagacgtgta gtgagaagaa
     601  tcgacaccac cctacctgag agtccccaag acaagccgat ccgacaaaac
     651  cgccgacttg gtaagacttc tcaactccct tatatggggg aagcagcgtt
     701  ggatgatatc cttcgctgga ttgaaggggt taatcctcat ccttcgatgg
     751  tcgctatccc agtgcccatc gcattcggaa ccatgtccgc aacggcatgg
     801  tgttctaagt ctgatgccgc tgtcttgcgg tgccgcttaa actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acatgtgcgg tacgtctata
     901  atgacgtatc ttctgctgct aaccgtcctc gtacggtttc atcccgcaaa
     951  tgcgggtctg tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac catcacactg cgttcgtgag atcttctcac gccagtgctt
    1051  tcttctcgga cgcggttcgc cgcgttcgtt tgttccgccc tgcgcggaat
    1101  aattttttca cttccgtcgt cagcggacga cgcgtttgct actacagacc
    1151  cggtccttgt ggtacggtgt ctgtcttcat gtcggacggt gttaatacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taagtctttg
    1251  ggcgccaaag cgcgcttttt gtgggagtcg tccgatttgg acgacactaa
    1301  aattcgtgac ggtcaatgct atgtccgtca cgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ttttctgtgc gtagagcact gggcttgtac
    1401  cccacagtgg gtgcatttaa ggcttatcta gttcgcgaat acggtcgcga
    1451  ctctcttaag gttcctatgc gtgggaccta cacttttggc agtgtttttc
    1501  actgcttgtc aactgaatct tcagttgacc tacgatctat tcctaaccat
    1551  catttagttg gtgggacatc tgcccatgtc ttaattgggc aaattagaat
    1601  taacgttcct ggctctacta ctaaaccctc acggtcggct gttcgtaggc
    1651  gtaatagacg catgcgacgt gacggttatc tcggtagttc cggttcttct
    1701  tcttctacag gggaatcgaa ttactgctcg gattgctctt ctcctcgtag
    1751  tatgccatct ccttccattt taaaaccttc cctaggtcgg gtcccgagca
    1801  tagatcagcg gttccggttt cctgcgggta cgcagctgcg cgtttccgtg
    1851  cctaggcgtg tcgatgacta tgtttacgtg tcgaccggtc aaaactttga
    1901  tgagttgtgc cacgcggttt gcacatacgt caaaaggtac aactctagga
    1951  aatcctttta cactcgattc gagagtggtg gagattacgt tgtcctgcgg
    2001  cgcgcatccg ttggaggcct tcacgtgttt gtgaagcgtg gtaactttac
    2051  tgctcggttt cctatttcgg cagtcaggta tgagagtcgc tacgccgcga
    2101  ctatgacgga tgttgggact agttgggttc cgaagggtta cgttcccgat
    2151  gctgagattg tgaaacgtcg gagaagtcgt aatcgtcgtc ctcctctatc
    2201  ccgtcgtgtg gtggaccaat cggtcccggc actaccatcg agtcccgtcg
    2251  aggttacttc agcttcgagt gacaggtctt cgtcatcaga aaaggcttcc
    2301  acagcttcat ttgactccgt aaagagttcg gattgggtga atgttggctc
    2351  ctctcgccga actactactg atgttcgtga atcgtgtctt actggtcgcg
    2401  gtaagatagg aaattttcct ttcccgagag gcactgtgta taatacgtct
    2451  gttgatgaac gtgcctataa acgtgttctt aagttgcgag actgtaccgt
    2501  ctgttcgttt ctccgcatac tgctagctcg tttgtcgagt tacaggcctt
    2551  tgagtgatga tttctttaat aagtgcgtca cttctcgatt tgtcgcgtgt
    2601  attgaacctg tggaatcggg tctagttaaa gtgcacttcc gttctgatgt
    2651  tttccgtgct tctttcccgt ttggggttaa tttgtatacc cgccacgcgt
    2701  ttgacattgg aagtggtagt cttttgggat tggatgctta tggtttttct
    2751  gaatccctga aggaaggata ttgctacatt cgccacttcg ccgaagttag
    2801  tttgagcatg gggcggattt tcttcaggag ggacgtcgat ttgggacctt
    2851  tccctcacat ttttgaagtg caacaccgtc ttgaaaggtt gtacgggaaa
    2901  gctgcgtcaa gatatggtgt tagaggttac tactcagccc cgcgctactt
    2951  tcactgttgc cacgatgatt cgccgaaacc gtcgacttcc tttaataagt
    3001  accataagat gggcggcgaa gataactcac tgataatcac ggataccgac
    3051  aggttgcgtg ctgtggggag tgcctatgaa aaggtgaaaa gaaatatacc
    3101  cgattcacta ttgattcggt ctgtggaaaa agacctcata gagtttaatc
    3151  agactctggt tgatatgcat cgatccagac cgggcgttgt cgtacctttt
    3201  caaatgagtg ggaatcagca agtaatgctc actagggcgt acccagagtt
    3251  taacattaat tttattcact ccgtacattc cgatcatcca gtagctgcgg
    3301  gttctagggc gttggagaat catctcgttc gtaaacacgc tggtaccgat
    3351  tattcggatg tggggggttg tccgctgttt catttacgcg cgggtcactc
    3401  cggtgttcat gtttgtagac cggtgtacga tgttaaagac gctcaccgta
    3451  gagtggtccg tcatcaccaa cttaacaagg tttcgctaga tcagagcgac
    3501  ggtgttaaac aagttggtgc ggtaaacacg aattccgtgt gcggtaacgt
    3551  tttgggagag tgttatcatg agtcggaggc gatagttatg gttcaagttt
    3601  atgacgtacc gctacatgag ttgtgtaggg ctatgataaa caagaaaact
    3651  tccgtgtgtt atatgaccat ggttacgcct ggtgagttgc tggatgcccg
    3701  tgagtccttt tttattaagg acttagattg ttcggtcgag ttggatcccg
    3751  tcgcggacca ggtcgtttac tgtttcaaca attccgcgta tacacacacg
    3801  tactccacta tatgtgagta tatgcgtact ccttgcttgg tggtggatgg
    3851  gtttttgttt actattgaaa tggtgtcgct caggtgtagt gttaattact
    3901  attgcgtcac taaatcgtcg gtttgtccaa gaattagtga gactaagcgg
    3951  ttacgctacc gtcggtgtga cagcgacttg attagaatca agattccccg
    4001  gtactctagt aaaacccgta gttgtttacc tgggtgttac tatttgtact
    4051  tggacgccaa gttcgtaagt cgcgtgtacg agtacgtggt caataactgc
    4101  gtcgtggtga acgcaaaaac ttttgagtgg acttggaatt acatcaaatc
    4151  ttgcaagtcg agagtggtga tcagcgggaa gattatacac cgagacgttc
    4201  caatcgcctt agagtactta gacgggtttt ctgctgttat gttgtccgct
    4251  ggtgtgaagg gtaggcaaaa cgcggaagcg ttttctagac gcttagccgc
    4301  tttttcaggt gaaacttcaa ttttcgagtt agtgaagttt gctatttccg
    4351  agaagtgccg cgacttattc atgggcattc aggacgctgt ggaaagatgc
    4401  gtgaaatcgt accttaggaa ctcgtttaac atgagtttcg tggacttgtc
    4451  cgatccctta cttataatta gcgaatattc ggagctggac gttcctatca
    4501  acttaccagg tttcggtagg atagcggatg gtgacgaaac tagacttatg
    4551  gaagacggta ttaaatcggc attgttgcgg aaagcagttc gagacgaggc
    4601  gcagttgaat cttaagagag gtaacacttc cgaaatcgtt ccgtgtgaag
    4651  acgatgataa ctcgaacggt gatgattcac gtgtttcgca cgattcggat
    4701  ggtggttcgt cttcgggcgg tagttccggc gggttgcgcg ctggagctgc
    4751  cccttctttg tttaggtgtg tactcaggaa gctgggtggg ggtttatgtt
    4801  tggcaaagaa agtgttggaa ctgttactca agcaggtggt tgagtcgttt
    4851  tcacgtctga aacgaaagac cactcgttta acgtctttcg ctaatttgtt
    4901  gcttgcaagg ctttcttgca ggttttccga tgattccgtt ttttctgcgg
    4951  tctgggaaat tgcggtcaat ctgaccagga tcgtcaatgg agtagttaag
    5001  acgaaactag agtgctttcg aaatttgttt cgattgattc ctaagttata
    5051  tgtcggttgt agggacgttg tgaaggacgt tagtaacgct tacaggtcgg
    5101  ctgttttgtt ttccgctgaa atttttggta agagttactc taaactttgt
    5151  cagttttgct tggaaacgtt tgacgtgggg cttattgaga tttccgctcg
    5201  taatttggga ttggaaactt gcgtctcaat ggcacaggct atttttgatg
    5251  tgttggtcgc ttttcctttg gggagcgtta gttttcccgt cgtttgtgct
    5301  agggttttcg gtgctctcgc tatggaagtg ggatcgaact tcttgtttaa
    5351  gaaagttttc ggtaaacccg aaactctagg tgaagatgcc ttccgtaggg
    5401  ccgtaagtat ggttttgagc gccaaagcgt ttgacaagct ttccgtagat
    5451  gcgaaaggtt tagttaggtg ctctggtgtt attcctgggg tgttaaggat
    5501  aatactatct tccttgtttt ccgaggcaga cgcttgggtg ggttacagta
    5551  aacatgaggt ttcttcccta cctatagtta ccttctgcgt gaagaaattg
    5601  tcttattctt tggagcggtg taaagaagag tgtatcactt tcgttgtcga
    5651  ttctgctaag aagattctga aatctttaac ttctgagttc aacgaatcta
    5701  ttcaaaattc cgacttgact agtggtgcta agtccttgta cgggcacgtg
    5751  agctcgatac tttccacctc tagcggtgtg attaataaag ccggaaacgc
    5801  tgtcgctact gttaaagctg tcgggagtga tattggtggt cgtgtgaaac
    5851  gcttgcgacc ccgtttttct ctctcccgtc actttgacga gcagactagt
    5901  gaatactact ctgctagtga ttgttccgaa ctggatgagt cgttgctcag
    5951  tgaaacacct ggtcttcgtg gaaatgggaa gtgtagagat ttatttcgta
    6001  tcatatctag acgcacggta gcgtgtagtg aatacttgat aaatcttttg
    6051  aaacgattaa cttcgcgtgc cactgaatac tcctactcgt atgtgatgga
    6101  tttgcttgtg aggttgtatg ttgcgacaga cgacgtcgtt aggcgatgca
    6151  ggtcctttac actcgactgt actgatagag cgtccaactt tatcgtcggg
    6201  tgtctcagtt ggtacaactt gcgttctggt gcttactctg caactcctgg
    6251  gttgggtggt ggtagtagaa gtttaacaac ggtttttccc accggtggct
    6301  ttgtgcgcgt tattgaggca cttgggaacg tcttatcagt agtgtttgat
    6351  gaggaattct ttagaacttt acttcatcgg ttgaggacag acgttgtggt
    6401  tttactggtg gagttcttga aaaaccttcc cgtatgtttg ttttcagtat
    6451  acactttctt tgagtgtcgg ggtagggttt ttcctttgag agagttccta
    6501  tggggctttt gtcgtttcgt ttgggaaatc gtcgaagggt tgtccatcaa
    6551  tgtctatcaa catctctctg ctgtcgttgt gaaagcgtat cgatgtgcgt
    6601  tcaatcgtca gtttagtgaa gaggatgaga ggacacttcg agtgatcacg
    6651  gaggcggaag gaagaattga gtttttgcga gttgttctcg cggaaatgga
    6701  aaggttccgt gctgcgtcaa acgagatgtc tttgtcgagg tcttctgata
    6751  gtccttcatt cccacctact tacggagaaa tagtggaatt gaatgacgat
    6801  tcctccgaca gtgcgctagt gataggtgtg gacgatggca ccggccgtgc
    6851  gatcgtcgac agtgagaccg attctgcgtc tggtagcgac agtgacgttt
    6901  ctattccgtt ggatcgcgat tttgaacaaa tcgggggtct tggtggaaac
    6951  ggtaacgtcg atgtctttcg gctgggtttg agatttactc tgaagttgtt
    7001  gcgcaacctt tttaacgcta gaagttttaa agtgttgtac gggttgttac
    7051  ttcagaccct tttttatggt ggttcggtaa ataaattcgt gtctcgtttg
    7101  gcctttagtc ttggtacttg cttacctttc gagttgttcc ggtttgcgtg
    7151  ttcggcgagg cggtcgttca agagtttggc atcatttgtt taccaaacta
    7201  accttttcag cgaagctaca gtggagcatt tgtttagctt ttcccggtta
    7251  ctttatgatt cccggtattt ctcgagtgtg ttttcggaag tcgagagatt
    7301  tgatttctat ttagatcatt tcctttcact cccgaagaga tatcttttcc
    7351  ctaattctaa ggttcgaggt cgtgctaggg ctccggttct tgtgactagg
    7401  actgaacaag tgacaccagt ccgtaagaga tcattaaacg acatattgga
    7451  ctctttggat tctctgaagg tgtcggacct caaagggaag tcgaccttcg
    7501  ttgatgacgg ggaatcggat tccggtagtg aacgttcggg tagttcgatc
    7551  tcgttcggtt ccatcaatga ggaagtctta aacgcggtaa acggtgatgg
    7601  cgtttgcgaa aaagctccgt tgatgaaaca cgccaccgcg cttagcaagt
    7651  tggaacccga ccctagtggt cgtaaagata ttcctgtttc taagaaaacc
    7701  tttacgcgcg gtgagtgttc gggcgtgaag tcgaaggcgg gcatgtgtga
    7751  ctacttggtg accttgaatt cttcgtttgg tacagtacct gacatgtacc
    7801  ctgttgcgcg tgacgtaacg tttaagaaac taactaacgc catgcgcgag
    7851  ttttattact cgcaaaaaat aaccttgtac gaacttcacg gaaagttgag
    7901  ttcttattgg gacgagttga aggtcgcagg tttcgataga aagttaacga
    7951  gaatggactt ggacgatgat gtctatgttg ttgatttcaa tcggaagctg
    8001  ttggtgggga gaaacggatc tcatccgttt cgtagtacat taaagtccta
    8051  ttgttttatg ttctgcaatg atgggttggt tccttgcccg ggttctcaga
    8101  agtatgatta tgctttgatt tccaatcaaa catcttttgt tgccgcgaac
    8151  tcgttcttac gtgctgtgga tggtaaggat ttgaccttta ccaatgagga
    8201  acacagcctt attgtttatg aggctcctcc tggtggtggt aagactcatt
    8251  ctttggtgaa ttgttacgcg gattattgca ataaagtatc gtgtttagta
    8301  gtgacagcta ataagaattc tcaaactgaa atatctcagc gtatatctag
    8351  tgaattgatg agtaggaagc gagctgctaa gtacgttact agtgcggctt
    8401  ctagagtgtt cactgtggat tcttatttga tgaatcattt gcgacttacg
    8451  actcagttac tgtttgtcga tgagtgcttt atggttcacg ctggagcaat
    8501  cggtgccgtg gttgaattca cgtcttgtaa agcggtagtt ttctttggtg
    8551  acagcaagca aatccactat attcaccgaa acgatctcgg ggtttctttg
    8601  ttgcatgata tcgatgcgtt tattcaaccg gagcatcgta tttacggcga
    8651  agtatcctat aggtgtcctt gggacatttg cgagtggctt tctgagtttt
    8701  acccgcgaca cgtagctact gctaatgtcg ggagtattgg gaaatcgagc
    8751  gtgtcgatag aggaaatcaa tgggtgtgat gacgtacctt acgacaaggc
    8801  agcgaagtac attgtgtaca ctcaggctga aaagaatgat ctgcaaaaac
    8851  atctcggtcg tttaaccgtg ggtcggacca aagtagtacc aattgtaaat
    8901  actgttcatg aggttcaagg agagacttat aagagggtac gcctggtgag
    8951  gtttaaatat caggaggata ccccgttttc ttcgaagaat catattgtgg
    9001  ttgctttgac tagacatgtt gattctttgg tttactccgt gcttactagt
    9051  aggaggtacg acgatactgc gactaacata ggtagggcaa aggaaatttt
    9101  tgataaattt cgttcgacga gtcactcgta cggttcgtca tcgttagaat
    9151  ggtaccttga aaaatttccc accgaatata aaggtagtaa agcatcctct
    9201  gctccgataa gttgcattaa cgaattcctt aatgaggtgg tcgttggttc
    9251  ttctgtcgtg cagttgggtg atgtgtctga agagctgagt tcacgtccct
    9301  ttgaatcagg gtgtgataat gttaccgtaa gagatactgc ccctcccgac
    9351  tccggtaact tacacgaacc ggctcgcgtt cggcgtagta aggtcacaag
    9401  caattcctcc aagaaaagcg tcgctacaag aaaaccttct gtcgtacgaa
    9451  agtcgtaatt acaactttat caagacagaa cggtttgttg gaccaagcga
    9501  ttttggtagg gcgatggctg ctgcggttat cgaacgttgt ttcaaaatgg
    9551  aagagatggc taagataagg tgtgatatta tatcccttac tgaggctaac
    9601  attttgaaat ggcttgataa gcgcactcct tgtcaaataa aggcagtgca
    9651  ggctgagttg aagcttccct tttcggtgga ggagcaaatt accaactaca
    9701  aactgatggt taaacgtgat gctaaggtaa aacttgatga ctcaagccta
    9751  tctaaacacc ccgctgccca gaacataatg tttcacaaga agtttattaa
    9801  tgctatattt tccccatgtt tcgatgagtt caaaaataga gtgttgtcct
    9851  cacttaatga caatatcgta ttcttcactg aaatgacgaa tgctgggtta
    9901  gcggaagttg tcagaagaat cattggtgac gacgacaacc tttttgttgg
    9951  ggaagtggac ttcagtaagt tcgataaatc tcaggatttg ttcattaagg
   10001  agtacgaacg tacgttatat tccgagtttg ggtttgatac cgaacttctc
   10051  gatgtttgga tggaaggtga gtatcgcgct agggcggcta ctttggatgg
   10101  tcaactgagc ttttcagttg atggtcaacg tcgttctgga ggttcgaata
   10151  cttggattgg gaattctttg gtcactctag gcattctctc gttatattac
   10201  gacgtttcaa agtttgagtt actccttgtt tccggtgacg attctttaat
   10251  ttattcaagt gagaagataa gtaacttttc ttcagaaatt tgcttagaaa
   10301  caggctttga gactaagttt atgtctccga gtgtgccata tttttgttca
   10351  aagtttgtgg ttcagaccgg taacaaaacc tgttttgtac ctgaccctta
   10401  caaattgtta gtaaagttgg gggctccgca aaacaagtta accgacgacg
   10451  agttatttga gttgtttact tcttttaagg acataacaca ggactttggt
   10501  gatcaagtgg ttttagagaa gttgaagttg ctagtcgaag ctaagtatgg
   10551  gtttactagc ggaactacta tgcccgctct gtgtgctata cattgtgtac
   10601  ggtccaatta tctatccttc gagaggttgt ttcctttcat taggggttgg
   10651  tatgttgtcg atgctttaaa gcttagacaa ctaaggaagt tcgccaattt
   10701  aatctgtgaa cgcgttgttc acgataatcg cgtgggttat ttttcgtact
   10751  ttgacaatcc gtttactaaa cccgacgcta gcgatggtca aatggacgac
   10801  ttgatgacta attgatcgtt tgttcagttc tcgctgagag ccaacgttgg
   10851  tagttgagtc gagatgtttg ctttcgcgag cgaaaaccaa gacttattgg
   10901  aagaaaagat atttcgtcgt agaacgtacc atcgtaagta ttttgatgac
   10951  gtggttaggg atttcactat tgatgttggt tataacgttg atgatcgtga
   11001  ccctacggtg ttggctgact atttctcgtt gtatttcttt ttgcttaaca
   11051  acgataacgt tgggccttta gcggcttcaa ttgtagtgag cccgccggtt
   11101  agcgggactt ataaaattcg agcgcacgtc gataagcaac caaattgcga
   11151  gggaaacgtg acttacgtta agactgtcga taagaatcgt tttgcaattc
   11201  tcataaaagc agtcccggct ccaatgagag gttattattc ttttcgggcg
   11251  tttcttaccg ataatgtcac tagcgaacgc agtgaattca tatgcagttt
   11301  tattggtagt agattccttt gttgttgtac gcaaacgata tccgaaaatt
   11351  tgaataaggt ttgttcgtcc tctttctcct ttagagcagt ctcagaaacc
   11401  gcgattaacg agctttctgt tgcgactgat gatgtagaag acgtcaagta
   11451  tgtgagaaaa cgagccgagg gtttttcaca ttgcgctgac ccgtaccctc
   11501  ctaggtgtta tcgcggcgct aatttaggcg attcttcagg ggttcaaagt
   11551  cgtacaatcg aagaagaagg ttataggacg gataccgcag gtgacatcgc
   11601  ggtcactatc ccgaacaccc cacttgttag tgctgtctct ccgtatgtcg
   11651  cagagtacaa cgaaaatacg cgttcgcgta tttcgttagt acgccgagtc
   11701  tgttgttacg ccgtttgtgt tttagtggtg tctcttctta taatgagcgg
   11751  tttgttaacc attatattca tatgatttga tgtagtaact tacgaggtac
   11801  aattagctaa aactcgccgt ttgactctgt ttaaacgggt ttcaatggac
   11851  tgtgtgattc aaggatttct gacttttctg gttggtatag ctgtgttttc
   11901  ggcctttgcc ggactgatta tcattgttat aacgatttat cggtgtacaa
   11951  ctaagcctgt tagaaacacc tctccttacg gcactcacgc cactgtctaa
   12001  gcaatatggt actcttgggt ttagactttg gtaccacgtt ttcgacggtg
   12051  gctatggcta cgtcttctga gttagttata ctcaaacaat ctaattcatc
   12101  gtatatacct acgtgtttgt ttctgcacgc agatcctaac agcgtgtctt
   12151  atggttacga tgcggagtat ttagcggctt caggggaacc cggctcgttt
   12201  tacaaagatt tgaaacggtg ggtcggttgt actgagaaga attaccaaag
   12251  ctacttgcac aagttgtcac cgtcttataa ggtgatagtg aaagagtttg
   12301  gagctaagag tatgccggtt ccatatttat cacctttgaa taatgatctt
   12351  gggctcagcg tcgctttgcc ttcattgatc gctttataca ccaagtccat
   12401  tttatcggat gcggaaagag tgtttaacgt gagttgtact gatgttatat
   12451  gttcggtacc tgctggttat aatacgttac agcgagcttt tacgcaacaa
   12501  agtgtatcct tgtcgggtta ctcttgcgtg tatattatta atgaaccttc
   12551  tgctgccgct tactccactc tacctaagtt gagttcggca gataagtatt
   12601  tggccgttta cgatttcggc ggtggaacct ttgatgtttc tatagttagc
   12651  gttagattac ctacattcgc tgttagaagt tcaggtggtg atatgaactt
   12701  aggcggtaga gacattgata gaaaattgtc tgataaaata tatgagttgg
   12751  ctgaatttct accgcaaaaa gagttgaatg tgtctagtct aaaggaagcc
   12801  ttatctcttc aaacggatcc agtcaagtat accgtaacta attatgggat
   12851  tagtggaaca gtatcaatcg accaaacgac tttgagggag atagcttcgg
   12901  tgtttataac tcgaacgata gacatactta cacaagttaa ggttaagtct
   12951  agtatgcccg aatcgcaaag tttgaagcta gtggtagtcg gtggaagctc
   13001  gtacctacca gggttgttgg atactttgga aactgtacct tttgtgtctg
   13051  ggataatacc agtggaagac gcaaggaccg ccgttgctag agggtgtgct
   13101  ttatatagcg agtgcttgga tggtaggtcc aaggccttat taatagattg
   13151  tgtcacgcat catttatcgg tcacgacatt tagtgcagac tcggttgttg
   13201  ttgctgcggc cggaagtcca attcctttcg aaggagaacg aaaactcaca
   13251  ttacgtaatt gcgttagtac gtctaattat caagcgagga tgttcgaagg
   13301  agattacgaa aaggttttcc gaaacgagcg tatatacgca gcttcggtat
   13351  cattgtttac tttaggagtt aactggcgcg tgcctaacga cgttgagatg
   13401  actctcgtga ccagagtgga ctcaatgggt aaagtggaat tctaccttaa
   13451  aggtccatct ggtgagttag ttaacgtgca aggtacttca cattatgatt
   13501  atgttggtat gcctcatcct actaggaagt tgttgaggct tagcgattac
   13551  aatgtaaact ccgcagcttt agttttagct ttgacgttga ctcgcgaaaa
   13601  acgagaaaaa tttcttttgc gaacgttatt tgatgcttta ctagcagact
   13651  tacgaaagac cgcaagctta agcgaatatt ctaagaagta cccgatcact
   13701  cgaaacgacg tcgatgtcgt ctcatcacgt atggggatcg ttgtttcaaa
   13751  agttttacgg ggaagcgatt tggaaagaat acctctctga atcaactcga
   13801  aatttcgatg agagaaacgt gtcgttggac cacactctga gttcgggtgt
   13851  ggtcgtccgt aggcagagtc ttttgaacgc gcctcaaggg actttcgaga
   13901  acgagttagc actattgtac aattcggtgg tgattaatga cttcgttgag
   13951  ttcaccggta tgccgttgaa gtccttgatg acaggtatcg aggaccgtaa
   14001  ggtacctgac gagttaatat ccgttgaccc gcatgaagtt ggatgtaaat
   14051  ttacgttaaa tgacgtggaa tcatatctaa tgagcagggg tgaagattcc
   14101  gctgatgtga cggcggtcga gcactcgtgg tgtttgagta attcttgcgg
   14151  tagattatta agttcgattg agatagatgc ttacaaaacc atagtgttta
   14201  ctaagaattt cgatagtagt atatctgggg tgactactaa gttagagact
   14251  tatttatcgt actgcatatc gttgtacaag aaacattgca tgaaagacga
   14301  tgattatttc aatcttatct tacctatgtt taattgttta atgaaagtgc
   14351  tggcatcgct tggtttgttt tatgagaaac atactgacaa tccgctactg
   14401  accggtatgc tcatagagtt ttgcctagaa aataaggtgt attactctac
   14451  ttttaaagta aatttagaca acgttagatt gtttaagtct aaagtgttgc
   14501  ctgtggtgtt aacggtctgg gatatatctg agcctgatga cccggtggat
   14551  gaaagggtgc taattccttt cgatcctacg gatttcgtgc tcgatttacc
   14601  taaattgaat atacacgaca caatggtggt ggtgggtaat caaatcagac
   14651  agttagagtg cgtagtcgag agcgatgctt tagacgattt atctcaacac
   14701  gttgacatac gtttagcagc ggacaacccc aatctacgcg ttgatctgcg
   14751  ttgggcaggg atgtttgtct actacggtgt ttatcggtgt gctattgata
   14801  gagcggtaga acgaccgacg ttatttagat tgccgcagaa gttactgagt
   14851  caggatgatg gcgaatcgtg ctcattacgc atgagtgccg tcgaagcttt
   14901  gtttaatctg gtgcaaaagg tgaacagaga cataaacgtt agacgtcagt
   14951  tcatgggacg tcacagtaaa gtggctttgc gactgtatcg caacttaggt
   15001  ttgaggtttc caccgatctc ttcagttagg ttaccggctc atcacagtta
   15051  tttatacgtc gatttttaca aaagagtacc tgacgatgct gttactgccg
   15101  acgaacttga aagtttgcgt caattacgtt cgtccgtgga cgttatgtgt
   15151  aaggacaggg tgtcaatcac acctccacca ttcaatcgac ttagaagagg
   15201  ttcttctaga acatttagag gtcgaggcgc acgcggtgcg agctcgcgtc
   15251  atatgggcag agacgtggcg acttccggtt ttaatttacc ttatcatggc
   15301  aggtcataca atacttccta agaccgatga caaagaaatg gatccggtga
   15351  gtgccgctgt gcccggtaag tatccggatg tcgttgagaa atttgtggcc
   15401  aataggtccg tagatgcgtt aatagaaggc gttataagta agttggatac
   15451  cagttcaata tacgaggatt ccactgaaaa atttactggt gaatacttga
   15501  aatacgtcat ggttactatg gatactttct tattagaaaa ctacaagacg
   15551  aaaacggaag atctgttggt tcacttagct atgatccaaa agaggttgtg
   15601  cactatatcc acgagcacta aaaccaagtt ccgcgataaa ggttgtatta
   15651  gttacgtgca agggggttcg cggtataagt taatggataa agtagttttt
   15701  cctttcatta tatcgaaatt taccgatagg gagaccccga acgctctacg
   15751  taagtatgct tgcactttcg aggagttaca cttatgtatg gctaggttga
   15801  gacccgactt atacgaaaat aaaaggacga ccaaagccgg gactccgcat
   15851  ttaaagggct acttatcagc cgactttctt tcgggttctc tcccagggta
   15901  ctccgaacat gagcgaggca tcattcttcg agcgtctgag tctatgttag
   15951  ctagacgtca aggttacgag gaggcaaccg agcttcttaa tctacgcgat
   16001  ttgggtaagt acttgtagtt ggtttgggga cggtaatatt ataccatcct
   16051  ttgagcgctg ctttaagggt cgttaattga cgactcttga tatatttact
   16101  aggttcgaat tatggacgac gaaacaaaga aattgaagaa caaaaacaag
   16151  gaaacgaaag aaggcgacaa tgttgttgcc gctgagtctt ctttcggttc
   16201  cttaaactta cacatcgatc caactctgat agcgatgaat gacgtgcgtc
   16251  agttgggtac ccaacagaac gctgctttaa acagagactt atttcttact
   16301  ctgaaaggga agcatcctaa cttacctgac aaagataagg actttcactt
   16351  agctatgatg ttgtatcgtt tagcagttaa gagttcatca ttacaaagcg
   16401  atgacgatgc tacgggtata acgtacactc gggagggtgt tgaagtggat
   16451  ttgcctgaca aactttggac tgacgtcgtg tttaactcca agggtattgg
   16501  caaccgtact aacgcccttc gagtttgggg tagaactaac gatgcccttt
   16551  acttagcttt ttgtagacaa aatcgcaatt tgagttatgg cggacgtccg
   16601  ctagatgcag ggattccggc cgggtatcat tacctgtgtg cagatttctt
   16651  gaccggagct ggcttgactg atttagaatg tgctgtgtac atacaagcta
   16701  aagaacaatt gttgaagaag cgaggagctg atgaagttgt agttaccaat
   16751  gtcaggcagc ttgggaaatt tagcacacgt tgatctgttg cgttccgact
   16801  cccggttttt atcgggatgg tggagtttca tcgtgaacgt gggtgatata
   16851  atagtccggt ttgcgttaca cgttcctaat gaagatatgc tgaatagttt
   16901  ttcagctata tcgaattgta cgatcatagc ggacggtagt gctttattaa
   16951  aagacaatac cgtggttgat cgtttagaag gtatgaatcc tttggcttac
   17001  ttgttaaatt tagcgaaaac gactactact atttgtttta ctatgtctaa
   17051  taaggttctt tttggtacta ctaaatctga accacttagt tgtttagcta
   17101  tcacgtcaga tcgagttttg ttcaaagtta ttatgggcac taacgttgat
   17151  gattctcggt gcggctgcag tatttggttt tacgacaatg gtacgtttca
   17201  aaacggattg atccgttgta acaatctcgt cgctttgttt agcgcgactt
   17251  agacacgaag tgaccgttcg gatttaattg ctgcaatgag ctttcgacgc
   17301  ttgtggttaa aggttatagc tgtagttacg gtattatggt acggtaaaga
   17351  accttccatt agtgaaggtt acaatgctct tatgaatgat gattttaagt
   17401  ttatcgatac gcatttttca aacgtttctt atgctaagaa atgttacgat
   17451  ttggctaatt tcgatttaga ctttctacgc atcgttatca ttcctttgag
   17501  tggtggtacg gtgaacgaat cgcgtgctaa tcacgctaac gtctcagaga
   17551  ttgtcgaatc gcatataagc gaccgagaca gaatgagcat cttgttgcgt
   17601  aataagcgta tccaaattcc ttcgctctta ccttgcggtg actagagtct
   17651  actcagtagt acgtctacta gtataacgta ttaaacactt tagtaaagag
   17701  ttttgtttaa gttgaacaat atgcgagctt actttagtgt taacgattac
   17751  ataagccttt tggctaaggt tggcgcagtt gtggaacgtt tatgcgatcc
   17801  cagcgtaact ctcacggaag tgatggacga aattaatgac tttaactcgt
   17851  tcctcgcttt ggtgcactct atgaagtcgg acatgaacgg agatcatcag
   17901  gatggtcacc atgagatggg tgaacacaag tctcggttgt tgtgcaacat
   17951  agaggcgaaa ctgcgagtac ttctcgacat cataagacgt cggttcactc
   18001  gcgaaaaact gctctgtacc agtgctacag atgtcatggg cttcttcgtc
   18051  gtgaggtaca tgagttctag tcacaccagt tttgagtccg taatgcacac
   18101  ggaattgaag ttagtagtta aggcggtgct gtcagatttg tcccgcacgc
   18151  ataaactaga ttttagcgag cgagcctttg cggcttacgg tatcctttta
   18201  caaaagggtg ccgtggcaac cgtttgtagt cagtttgaca ttaatttagt
   18251  ttctccgtct tgcgtgtagg ttaatacgct tctcagaacg tatggttgta
   18301  ttaactaact ttaattcgaa caaatttatt gtttaaagtc tgtgagttac
   18351  gatgaacgat actagcggac aaactttcgt ttctgtgaac ctttctgacg
   18401  aaagcaacac agcgagcact agagttgaaa acgtaaaatc ggaagcggat
   18451  cgcttggagt ttttacgtaa aatgaatccc gtcattattg acgctctggt
   18501  gcggaaaacc aattatcagg gcgctcgctt tcgtgcgaga ataataggag
   18551  tatgcgtgga ttgtggtaga aaacacgaca aggcgctcaa gactgaacgt
   18601  aagtgtaagg tcaacaatac gcagtctcag aacgaggtgg cgcatatgtt
   18651  gatgcacgat cccgttaaat atttaaacaa aagaaaggct agagcctttt
   18701  ctaacgcaga gatgtttgcg attgaattgg ttttgcacac caaggaaaag
   18751  caattggcgg ttgatttggc cgccgaaagg gagaagacga ggttagctcg
   18801  taggcacccg atgcgttctc cagaggaaac tccggaacat tataaattcg
   18851  gtatgaccgc taaagcgatg ttaccggaac tcaacgctgt aggcgttggt
   18901  gataacgaag acacttcgtc ggaataccca gtaagtctga gcgtttccgg
   18951  tggagttctc cgtgaacacc acttcgtctg attgaagtgg acggaataag
   19001  ttccttgcgg aactttatat cgggttgata aaaaccctta tgatggtgat
   19051  atatcactag acaataaccg gatgggtaaa gtctttaaaa tgatcgaggg
   19101  gaaagattaa ccgtatcctc tcgttggtct aagctcccac agagtggtag
   19151  tggtctcaag tgaggcttaa cgtatgtgtg aaccaaagaa gttctcctta
   19201  gagtatgtgt tgtttaccca acacactgtc cctatggggg gccaacatag
   19251  gtcca