Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate NZRB-G90, complete genome.

ACC No: FJ525432

Dated: 2010-04-07 | Length: 19255 | CRC: 1604079359

                
ID   FJ525432; SV 1; linear; genomic RNA; STD; VRL; 19255 BP.
XX
AC   FJ525432;
XX
DT   08-FEB-2009 (Rel. 99, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate NZRB-G90, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19255
RX   PUBMED; 20352212.
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   "Isolates of Citrus tristeza virus that overcome Poncirus trifoliata
RT   resistance comprise a novel strain";
RL   Arch. Virol. 155(4):471-480(2010).
XX
RN   [2]
RP   1-19255
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   ;
RL   Submitted (04-DEC-2008) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland 0630, New Zealand
XX
DR   RFAM; RF00193; CTV_rep_sig.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19255
FT                   /organism="Citrus tristeza virus"
FT                   /host="Poncirus trifoliata"
FT                   /isolate="NZRB-G90"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /collection_date="03-Jul-2005"
FT                   /note="resistance-breaking genotype: RB"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9458
FT                   /codon_start=1
FT                   /product="p349 protein"
FT                   /db_xref="GOA:B9VB20"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="InterPro:IPR022054"
FT                   /db_xref="InterPro:IPR022108"
FT                   /db_xref="InterPro:IPR022239"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB20"
FT                   /protein_id="ACM49862.1"
FT                   /translation="MSKLRGSFWSSAFAASSDYTISRIWRKLNTIVVLHYFGSVRVTKV
FT                   IRDESADMPIVPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGNPVINASGVVRPR
FT                   SVAGFSRFSLCKPPLSSAAKKSIRQAKRESVSPFSRASSLFSREVPRGTRSKLRRRVVR
FT                   KTDTTLPESPQDKPIRQNRRLGKTSHLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIA
FT                   FGTMSATAWCSKSEAAVLRCRLNYHAAETDFSTQEKHVRYVYNDVSSAANRPRTVSSRK
FT                   CGSVSPSKSKLGVEVPSGRDHHTAFVRSSHASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVFMSDGVNTARLDVVAPAYYAYAKSLGAKARFLWESSDLDDAKI
FT                   RDGQCYVRHVFDVALYFGRRADFSVRRVLGLYPTVGAFKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTESSVDLRSIPNHHLVGGTSAHVLIGQIRVNVPGSTSKPSRSAVRRRNR
FT                   RMRRDGYLGSSGSSSVIGESNYCSDCSSPRSIPSPSILKPSLGRVPSIDQRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGQNFDELCHAVCTYVKRYNSRKSFYTRFESGGDYVVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENHYAATMTDNGISWVPKGYVPDVEIVKRRRSRSRR
FT                   LPPPRRVVDQSVPALPSSSVEVTSASSDRSSSSEKASTPSCDSVRSSDWVNVGYSHRTT
FT                   TKVRESRFTGRGKIGNFSFPRGTVYNTPVDERAYKRVLKLRDTTACSFLRILLARLSSY
FT                   RPLSDDFFNKCVTSRFVACIEPVESGLVKVHFRSDVFRASFPFGVNLYTRHAFDIGSGS
FT                   LLKLDTYGFSESLKEGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPYIFEVQHRLERLYG
FT                   KAASRYGVRGHYSASRYFHCCYDDSPKPLTSFNKYHKMGGEDNSLIITDTDRLRAVGSA
FT                   YEKVKRNIPDSLLIRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTRAYPEF
FT                   NINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHVCRPVY
FT                   DVKDAHRRVVRHHQLNKVSLDQSDGVKQVGAVNTNSVCGNTLGECHHVSEAIVMVQVYD
FT                   VPLHELCRAMINKKASVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQVVYCFNN
FT                   SAYTHTYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVCPRISETKRLRY
FT                   RRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKTFEWTW
FT                   NYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLAAFSGE
FT                   TSIFELVRFAISEKCRDLFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISEYSELD
FT                   VPINLPGFGRIVDGDETRLMEDGIKSALLRKAVRDEAQLNLKRGNTSEIVPCEDDEDST
FT                   GDDSRVSRDSDGGSSSGGSSGGLRAGAAPSLFRCLLRKLGGGLCLAKKVLELLLKRVVE
FT                   SFSRLKRKTTRLASFANLLLARLSCGFFDDSVFSAVWEIAVNLTRIVDGVVKTKLECFR
FT                   NLFRLIPKLYVGCKDVVKDVSNAYRSAVLFSAEIFGKSYSKLCQFCLETFDVGLIEISA
FT                   RNLGLGTCVSMAQAIFDVLVAFPLGSVSFSVVCARVFGALAMEVGSNFLFKKVFGKPET
FT                   LGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSDADAWVGYSK
FT                   HEVSSLPIVTFCVKKLSYSLERCKEACIAFVVDSAKKILRSLTSEFNESIQNSDLTNGA
FT                   KSLYGHVSSILSTSSGVINKAGNAVATVKAVGSDIGGRVKRLRPRFSLSRHFDEQTSEY
FT                   YSASDCSELDESLLSESPGLRGNGRCRDLFRIVSRRTVACSEYLINLLKQLTSRASEYS
FT                   YSYVMDLLVRLYVATDDVVRRCKSFTFDCTDKASNLIVGCLSWYNLRSGAYSATPGLGG
FT                   GSRSLTRVFPTGGFVRVGGVLWNVLSVVFDEEFFRTLLHRLRTDVVVLLVEFLKNLPVS
FT                   LFSVYTFIGCRGRIFPLREFLWGFCRSVWEIVEGLSINVYQHLSAVVVKAYRSVFNHRF
FT                   SEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEMSLSRSSDSPSFPPTYGEIVEL
FT                   NDDSSDSALVIGVDNGTGRAIVDSETDSASGSDSDVSIPLDRDFEQIGGLGGNGNVDVF
FT                   RLGLRFTLKLLRNLFNARSFKVLYGLLIQTLFYGGSVNKFVSRLVFSLGTCIPFELFRF
FT                   ACSARQLFKSLALFVHQTSLFSEATVEPLFSFSRLLYDSRYFSNVFSETERFDFYLDHF
FT                   LSLPKRYLFPNFRVRGCARAPVLVTRTEEVTPVCKRSLNDILDSLDSLKVSDLKGKSTF
FT                   VDDGESDSGSERSGSSISFGSINEEVLNAVNGDGVCEKAPLMKHATALSKLEPDPSGRK
FT                   DIPVSKKTFTRGECSGVKSKVGMCDYLVTLNSSFGTVPDMYPVARDITYKKLTNAMREF
FT                   YYSQKITLYELHGKLSSYWDELKVAGFDRKLTRMDLDDDVYVVDFNRKLLVGRNGSHPF
FT                   RSTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFTNEEHN
FT                   LIVYEAPPGGGKTHSLVNCYADYCDKVSCLVVTANKNSQTEISQRISSELMSRKRAAKY
FT                   VTGAASRVFTVDSYLMNHLQLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVFFGDSKQ
FT                   IHYIHRNDFGVSLLHDIDAFIQPEHRIYGEVSYRCPWDICERLSEFYPRHVATANVGSV
FT                   GKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRTKVVPIVNTVHEV
FT                   QGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATNIDRAK
FT                   EIFDKFRSTNHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGSSVVQLG
FT                   DVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVASNSSKKSVATRKPSVV
FT                   RKS"
FT   CDS             <9382. .10815
FT                   /codon_start=1
FT                   /product="RdRp protein"
FT                   /note="start codon not determined; likely expressed by +1
FT                   ribosomal frameshift"
FT                   /db_xref="GOA:B9VB21"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB21"
FT                   /protein_id="ACM49863.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPSEFGRAM
FT                   AAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIKAVQAELKLPFSVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPCFDEFKNRVLSSLNDNIV
FT                   FFTEMTNAGLAEVIRRIVGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDTEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LISGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQNKLTDDELFELFTSFKDITQDFGDQVVLEKLKLLVEAKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERIVYDNRVGYFSYFD
FT                   NPFTKPDASDGQTDDLVTS"
FT   CDS             10864. .11775
FT                   /codon_start=1
FT                   /product="p33 protein"
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB22"
FT                   /protein_id="ACM49864.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYDVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDNQPNCEGNVTYVKT
FT                   ANKSRFAILVKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENL
FT                   SKVCSSSFSFRAVSETANNEFPVATDDVEDIKYVRKRAEGFSHCADPYPPRCYRGANLG
FT                   DSSGVQSRTIEEEGYRTDTAGNVAVTIPNTPLVSAVSPYVAEYNENTRSRISLIRRVCC
FT                   YAVCVLVVSLLIMSGLLAIIFI"
FT   CDS             11845. .12000
FT                   /codon_start=1
FT                   /product="p6 protein"
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB23"
FT                   /protein_id="ACM49865.1"
FT                   /translation="MDCVIQGFLTFLVGIAVFSAFAGLIIIVITIYRCTTRPVRNTSPY
FT                   GTHATV"
FT   CDS             12006. .13790
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /db_xref="GOA:B9VB24"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB24"
FT                   /protein_id="ACM49866.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGGPGSFYKDLKRWVDCTEKNYQSYLHKLSPSYKVIVKEFGAKSMP
FT                   VPYISPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELADFLPQKELNVSSLKEALSLQTDPVKYTVTNYG
FT                   ISETVSIDQTTLREIASVFITRTVDILTQVKVKSSVPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYSECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   LPNDVEMTLVTRVDSMGKVEFYPKGPSGELVNVQGTSHYDYVGMPRPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDALLADLRKTASLSEYSKKYPITRNDVDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13714. .15321
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB25"
FT                   /protein_id="ACM49867.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDEGNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVEFTGMPLRSLMTGIEDRKVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTMMFT
FT                   KSFDSSVSGVITKLQTYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLDLIDEK
FT                   LTDHALLTGMLIEFCLENKVYYSTFKYNLDNVRLFKSKVLPVVLTVWDISEPDYPMDER
FT                   GLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLEYVVESDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRVVERPTLFRLPQKLLNQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHGYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRIFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRLHNAS"
FT   CDS             15296. .16018
FT                   /codon_start=1
FT                   /product="p27 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB26"
FT                   /protein_id="ACM49868.1"
FT                   /translation="MAGYTMLPNTEDKEMNPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16112. .16783
FT                   /codon_start=1
FT                   /product="p25 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB27"
FT                   /protein_id="ACM49869.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWADVVFNSKGIGDRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAREQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
FT   CDS             16749. .17252
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB28"
FT                   /protein_id="ACM49870.1"
FT                   /translation="MSGSLGNLTHVDLLRSDSRFLSGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAVSNCTIIADSSALLKDNTVVDRLEGTNPLAYLLNLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAIASDRVLFKVIMGTNVDDSRCGCSIWFYNNGTFQNGLIRCNNLVAL
FT                   FSAT"
FT   CDS             17286. .17645
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB29"
FT                   /protein_id="ACM49871.1"
FT                   /translation="MSFRRMWLKVMAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRANPTNVSEIVESHMSDRDRMSILL
FT                   RNKRIQIPSLLPCGD"
FT   CDS             17721. .18269
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /db_xref="InterPro:IPR021742"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB30"
FT                   /protein_id="ACM49872.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYAILLQKG
FT                   AVATVCSQFDINLVSPSCV"
FT   CDS             18352. .18981
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB31"
FT                   /protein_id="ACM49873.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPFI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAETFAIELVLYTKEKQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPEFNAVGVGDNEDTSSEYPVSLSISGGVLREHHFI"
XX
SQ   Sequence 19255 BP; 4722 A; 3836 C; 4822 G; 5875 T; 0 other;

fj525432 Length: 19255  07-APR-2010  Type: N  Check: 5083  ..

       1  aatttcacaa attcaacctg ttcgcccaga aaacacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttacactatg tcgaaactca gaggaagctt ctggtcttcg gctttcgctg
     151  ctagcagcga ttacacgatc tcgcgcatct ggcgcaaact taacaccata
     201  gtagtcctgc actactttgg ttctgttaga gtcaccaagg tgattcgtga
     251  cgaatcggcc gatatgccga tagtccctct acggaaatct gtatttccgt
     301  tctctgttcg cgcggctgtt cgcgcaattc gtgccgctgg gcgtcctctc
     351  gacgctccgc attctgggtg cctctgtggc aatcccgtta tcaacgcatc
     401  tggcgttgtt cgtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc cctctcctcc gccgctaaga agtccattcg tcaggcaaag
     501  cgggaatctg tttccccttt tagccgggct tcttctctct tctctaggga
     551  agtccctcgc ggcacacgtt ctaaacttcg aagacgtgta gtgagaaaaa
     601  ccgacaccac cctacctgag agtccccaag acaagccgat ccgacaaaac
     651  cgccgacttg gtaagacatc tcacctccct tatatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga ttgaaggggt taatcctcat ccatcgatgg
     751  tcgctatccc agtgcccatc gctttcggaa ccatgtccgc gacggcatgg
     801  tgttctaagt ctgaagccgc tgttttgcgg tgccgcttaa actatcacgc
     851  ggctgaaact gatttctcca ctcaggagaa acatgtgcgg tacgtctata
     901  atgacgtatc ttctgctgct aaccgtcctc gtacggtttc gtcccgcaaa
     951  tgcgggtctg tttctcccag taagtctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac catcacactg cgttcgtgag atcttctcac gccagtgctt
    1051  tcttctcgga cgcggttcgc cgtgttcgtt tgttccgccc tgcgcggaat
    1101  aattttttca cttccgtcgt cagcggacga cgcgtttgct actacagacc
    1151  cggtccttgc ggtacggtgt ctgtcttcat gtcggacggt gttaacacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taagtcattg
    1251  ggcgccaaag cgcgcttttt gtgggagtcg tccgacttgg acgacgctaa
    1301  aattcgtgac ggtcaatgct atgtccgtca cgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ttttctgtgc gtagagtact gggcttgtac
    1401  cccacagtgg gtgcatttaa agcttatcta gttcgcgaat acggtcgcga
    1451  ctctcttaag gttcctatgc gtgggaccta cacttttggc agcgtttttc
    1501  actgcttgtc gactgaatct tcagtcgacc tgcgatctat tcctaaccac
    1551  catttagttg gtgggacttc tgcccatgtc ttaattgggc aaattcgagt
    1601  caatgttcct ggctctactt ctaaaccctc acggtcggct gttcgtaggc
    1651  gtaacagacg catgcggcgt gacggttatc tcggtagttc cggttcttct
    1701  tctgttatag gggaatcgaa ttactgctcg gattgctctt ctcctcgcag
    1751  tataccatct ccttccattt taaaaccttc cctaggtcgg gttccgagca
    1801  tagatcagcg gttccggttt cctgcgggta cgcagctgcg cgtttccgtg
    1851  cctaggcgag tcgatgacca tgtttacgtg tcgaccggtc aaaactttga
    1901  tgagttgtgc catgcggttt gcacatacgt caaaaggtac aactctagga
    1951  aatcctttta tactcgattc gagagtggtg gagattacgt tgttctgcgg
    2001  cgtgcttccg ttgggggcct tcacgtgttt gtgaagcgtg gtaactttac
    2051  tgctcgattt cctatttcag cagtcaggta tgagaatcac tacgccgcga
    2101  ccatgacgga taatgggatt agttgggttc cgaagggtta cgttcccgat
    2151  gttgagatcg tgaaacgtcg gagaagtcgt agtcgtcgtc ttcctccacc
    2201  ccgtcgtgtg gtggaccaat cggtcccagc attaccgtcg agttccgttg
    2251  aggttacttc ggcttcgagt gataggtctt catcatcaga gaaggcttct
    2301  acaccttcat gtgactcggt aaggagttcg gattgggtga atgtcggcta
    2351  ctctcaccga actactacta aggttcgtga atcgcgtttt accggtcgtg
    2401  gtaagatagg aaatttttct ttcccgagag gcactgtgta caatacacct
    2451  gttgatgaac gtgcctataa acgtgttctt aagttgcgag atactacagc
    2501  ctgttccttt ctccgcatac tgctagctcg tttgtcgagt tacaggcctt
    2551  tgagtgatga cttctttaat aagtgtgtca cttctcgatt tgtcgcgtgt
    2601  attgaacctg tggaatcagg tctagttaaa gtgcacttcc gttctgatgt
    2651  tttccgtgct tctttcccgt ttggggttaa tctgtatacc cgccacgcgt
    2701  ttgacatcgg aagtggtagt cttttgaaat tggatactta tggcttttct
    2751  gaatccctga aggagggata ttgctacatt cgccatttcg ccgaagtcag
    2801  tttgagcatg gggcggattt tcttcaggag ggacgtcgat ttgggacctt
    2851  tcccttacat tttcgaagtg caacaccgtc ttgaaaggtt gtacgggaaa
    2901  gctgcgtcaa gatatggtgt tagaggtcac tactcagcct cgcgctactt
    2951  tcactgttgc tacgatgatt cgccgaaacc gttgacttcc tttaataagt
    3001  accataagat gggcggtgaa gataactcac tgataatcac ggacaccgac
    3051  aggttgcgtg ctgtggggag tgcctatgaa aaggtgaaaa gaaatatacc
    3101  cgattcgtta ttgattcggt ctgtggaaaa ggaccttata gagtttaatc
    3151  agactctggt tgatatgcat cgatccagac cgggtgttgt cgtccctttt
    3201  caaatgagtg agaaccagca agtaatgctc actagggcat acccagagtt
    3251  taatattaat tttattcact ccgtacattc cgatcatcca gtagctgcgg
    3301  gttctagggc gttggagaat catctcgttc gtaaacacgc cggtaccgat
    3351  tattcggatg tggggggttg tccgctgttt catttacgcg cgggtcactc
    3401  cggtgttcat gtttgtagac cggtgtacga tgttaaagac gctcaccgta
    3451  gagtagtccg tcatcatcaa cttaacaagg tttcactaga tcagagcgac
    3501  ggtgttaaac aagttggtgc ggtaaacacg aactccgtgt gcggtaatac
    3551  tttgggagag tgtcatcatg tatcggaggc gatagttatg gttcaagttt
    3601  atgacgtacc gctacatgag ttgtgtaggg ctatgataaa caagaaagct
    3651  tccgtgtgtt atatgaccat ggttacgcct ggcgagttgt tggatgcccg
    3701  tgagtccttt tttattaagg acttagattg ttcggtcgag ttggatcccg
    3751  tcgcggacca ggtcgtttac tgtttcaaca attccgcata tacacacacg
    3801  tactccacta tatgtgagta tatgcgcact ccttgcttgg tggtggatgg
    3851  gtttttgttt actattgaaa tggtgtcgct caggtgcagt gttaattact
    3901  attgcatcac taaatcgtcg gtctgtccaa gaattagtga gactaagcgg
    3951  ttacgctacc gtcggtgtga cagcgacttg attagaatca agattccccg
    4001  gtactctagt aagacccgta gttgtttacc tgggtgttac tatttgtact
    4051  tggacgccaa gttcgtaagt cgcgtgtacg agtacgtggt caataactgc
    4101  gtcgtggtga acgcaaaaac ttttgagtgg acttggaatt acatcaaatc
    4151  ttgcaagtcg agagtggtga tcagcgggaa gattatacac cgagacgttc
    4201  caatcgctct agagtacttg gacgggtttt ctgctgttat gttgtccgct
    4251  ggtgtgaagg gtaggcaaaa cgcggaagcg ttttctagac gcttagctgc
    4301  tttttcaggt gaaacttcaa ttttcgagtt agtgaggttt gctatttccg
    4351  agaagtgccg cgatttgttc atgggcattc aggacgctgt ggaaagatgc
    4401  gtgaaatcgt accttaggaa ctcgtttaac atgagtttcg tggacttgtc
    4451  cgatccctta cttacgatta gcgagtattc ggagctggac gttcctatca
    4501  acttaccagg tttcggtagg atagtggatg gtgacgaaac tagacttatg
    4551  gaagacggta ttaaatcggc attattgcgg aaagcagttc gagacgaggc
    4601  acagttgaat cttaagagag gtaacacttc cgaaatcgtt ccgtgtgaag
    4651  acgatgagga ctcgaccggt gatgattcac gtgtttcgcg cgactcggat
    4701  ggcggttcat cttcgggcgg tagttccggc gggttgcgag caggagctgc
    4751  cccttctttg tttaggtgtt tactcaggaa gctgggtggg ggtttatgtt
    4801  tggcaaagaa agtgttggaa ctgttactca agcgggtggt tgaatcgttt
    4851  tcacgtctga aacgaaagac cactcgttta gcgtctttcg ctaatttgtt
    4901  gcttgcgagg ctttcttgcg ggtttttcga tgattccgtt ttttctgcgg
    4951  tctgggaaat tgcggtcaac ctgaccagga tcgtcgatgg agttgttaag
    5001  acgaaattag agtgctttcg aaatttattt cgattgattc ctaagttgta
    5051  tgtcggttgt aaagacgttg tgaaagacgt tagtaacgct tacaggtcgg
    5101  ctgttttgtt ttccgctgaa atttttggta agagttactc taaactttgt
    5151  cagttttgct tagaaacgtt tgacgtgggg cttattgaga tttccgctcg
    5201  taatttggga ttaggaactt gcgtctcaat ggcacaggct atttttgatg
    5251  tgttggtcgc ttttcctttg gggagcgtta gtttttccgt cgtttgcgct
    5301  agggttttcg gtgccctcgc tatggaagtg ggatcgaact tcttgtttaa
    5351  gaaagttttc ggtaaacccg aaactctagg tgaagacgcc ttccgtagga
    5401  ccgtgagtat ggttttgagc gccaaagcgt ttgacaagct ttccgtagac
    5451  gcgaaaggct tagttaggtg ctctggtgtt atccctgggg tgttaaggat
    5501  aatactatct tccttgtttt ccgacgcaga cgcttgggtg ggttacagta
    5551  aacatgaagt ttcttccctt cctatagtta ccttctgcgt gaagaaattg
    5601  tcttattctt tggagcggtg taaggaagca tgtatcgctt tcgttgtcga
    5651  ctctgctaag aagattctga gatctttaac ttctgagttc aacgaatcta
    5701  ttcaaaattc cgacttgact aatggtgcta agtctttgta cgggcacgtg
    5751  agctcgatac tttccacctc tagtggtgtg attaataaag ccggaaacgc
    5801  tgtcgctact gttaaagcgg tcgggagtga tattggtggt cgtgtgaaac
    5851  gcttgcgacc ccgtttttct ctctcccgtc actttgacga gcagactagt
    5901  gaatactact ctgctagtga ttgttccgaa ctggatgagt cgttgctcag
    5951  tgaatcacct ggtcttcgtg gaaatgggag gtgtagagat ttatttcgta
    6001  tcgtatctag acgcacggta gcgtgtagtg aatacttgat aaatcttttg
    6051  aaacaattaa catcgcgtgc cagtgaatac tcctactcgt atgtgatgga
    6101  tttgcttgtg aggttgtatg ttgcaacaga cgatgtcgtt aggcgatgca
    6151  agtcctttac attcgactgt actgataaag cgtccaatct tatcgtcggg
    6201  tgtctcagtt ggtacaactt gcgttctggt gcctactccg caactcctgg
    6251  gttgggtggt ggtagtagaa gtttaacgag ggtttttccc accggtggtt
    6301  ttgtgcgcgt cggtggggta ctttggaacg tcttatcagt ggtgtttgat
    6351  gaggaattct ttagaacttt acttcatcgg ttgaggacag acgttgtggt
    6401  tttactggtg gagttcttga aaaaccttcc cgtaagtttg ttttcagtat
    6451  acactttcat tgggtgtcgg ggtaggattt ttcctttgag agaattccta
    6501  tggggctttt gtcgttccgt ttgggaaatc gtcgaagggt tgtccatcaa
    6551  tgtctatcaa catctctctg ctgtcgttgt gaaagcgtat cgaagtgtgt
    6601  tcaatcatcg gtttagcgaa gaggatgaga ggacacttcg agtgatcaca
    6651  gaggcggaag gaagaattga gtttttgcga gttgttctcg cggaaatgga
    6701  aagattccgt gctgcgtcaa acgagatgtc tttgtcgagg tcgtctgata
    6751  gtccttcatt cccacctact tacggagaaa ttgtggaatt gaatgacgat
    6801  tcctccgaca gtgcgctagt gataggtgtg gacaatggca ccggccgcgc
    6851  gatcgtcgac agtgagaccg attctgcgtc tggtagcgac agtgacgttt
    6901  ctattccgtt ggatcgcgat tttgagcaaa tcgggggcct tggtggaaac
    6951  ggtaacgtcg atgtttttcg gctgggtttg agatttactc tgaagttgtt
    7001  gcgcaacctt tttaacgcta gaagttttaa agtgttgtac gggttgttaa
    7051  ttcagaccct tttttatggc ggttcggtaa ataaatttgt gtctcgtttg
    7101  gtctttagtc ttgggacttg catacctttc gagttattcc ggtttgcgtg
    7151  ttcggcgagg cagttgttca agagtttggc attatttgtt caccaaacta
    7201  gccttttcag cgaagctacg gtggaacctt tgtttagctt ttcccggtta
    7251  ctttatgatt cccggtactt ctcgaatgtg ttttcggaaa cagagagatt
    7301  tgatttctat ttggatcatt tcctttcact cccgaagaga tatcttttcc
    7351  ctaattttag ggttcgaggt tgtgctaggg ctccggttct tgtgactagg
    7401  accgaagaag tgacaccagt ctgtaagaga tcattaaacg acatattgga
    7451  ctctttggat tctctgaagg tgtctgacct caaagggaag tcgacgttcg
    7501  ttgatgatgg ggagtcggat tccggtagtg aacgttcggg tagttcgatc
    7551  tcgttcggtt ccatcaacga ggaagtctta aacgcggtaa acggtgatgg
    7601  cgtttgcgaa aaagctccgt tgatgaaaca cgctaccgcg cttagcaagt
    7651  tggaacccga ccctagtggt cgtaaagata ttcctgtttc caagaaaacc
    7701  tttacgcgcg gtgagtgttc gggcgtgaag tcgaaggtgg gcatgtgtga
    7751  ttacctggtg accttgaatt cttcgtttgg tacagtacct gacatgtacc
    7801  ctgtcgcgcg tgacataacg tataagaaac taactaacgc catgcgcgag
    7851  ttttattact cgcaaaaaat aaccttgtac gaacttcacg gaaagttgag
    7901  ttcttattgg gacgagttga aggtcgcagg tttcgataga aagttaacga
    7951  gaatggactt agacgatgat gtctatgttg ttgatttcaa tcggaagctg
    8001  ttggtgggga gaaatgggtc tcatccgttt cgtagtacat taaagtccta
    8051  ttgttttatg ttctgcaatg atgggttggt tccttgcccg ggttctcaga
    8101  agtatgatta tgctttgatt tctaatcaaa cgtcttttgt tgccgcgaac
    8151  tcgttcttac gtgctgtgga tggtaaggat ttgactttta ccaatgagga
    8201  acacaacctt attgtttatg aggctcctcc tggtggtggt aagactcatt
    8251  ctttggtgaa ttgttacgcg gattattgcg ataaagtatc ctgtttagta
    8301  gtgacagcta ataagaattc tcaaactgag atatctcagc gtatatctag
    8351  tgagttgatg agtaggaagc gagctgctaa gtacgttact ggtgcggctt
    8401  ctagagtgtt cactgtggat tcttacttga tgaatcattt gcaacttacg
    8451  actcagttgc tgtttgtcga tgagtgcttt atggttcacg ctggagcaat
    8501  cggcgccgtg gttgaattca cgtcttgtaa agcagtagtt ttctttggtg
    8551  acagcaagca aatccattat attcaccgaa acgatttcgg ggtttctttg
    8601  ttgcatgata ttgatgcatt tattcaaccg gagcatcgta tttacggcga
    8651  agtgtcctat aggtgtcctt gggacatttg tgagcggctt tctgagtttt
    8701  acccgcgaca cgtagctact gctaatgtcg ggagtgtcgg gaaatcgagc
    8751  gtgtcgatag aggaaatcaa tgggtgtgat gacgtacctt acgacaaggc
    8801  agcgaagtac attgtgtaca ctcaggctga aaagaacgat ctgcaaaaac
    8851  atctcggccg tttaaccgtg ggtcggacca aagtagtacc aattgtaaat
    8901  accgttcatg aggttcaagg agagacttat aaaagggtac gcctggtgag
    8951  gtttaaatat caagaggata ccccgttttc ttcgaagaat catattgtgg
    9001  ttgctttgac tagacatgtt gattctttgg tttactccgt gcttactagt
    9051  aggaggtacg acgatactgc gactaacata gatagggcaa aggaaatttt
    9101  tgataagttt cgttcgacga atcactcgta cggttcatca tcgttagagt
    9151  ggtaccttga aaaatttcct accgaatata aaggtagtaa agcatcctct
    9201  gccccgataa gttgtattaa cgaattcctt aatgaggtgg tcgttggttc
    9251  ttctgtcgtg cagttgggcg acgtgtctga agaactgagt tcacgtccct
    9301  ttgaatcagg gtgtgataat gttaccgtaa gagacactgc ccctcccgac
    9351  tccggtaacc tacacgaacc ggctcgtgtt cggcgtagta aggtcgcaag
    9401  caattcctcc aagaaaagcg tcgctacaag aaaaccttct gtcgtacgaa
    9451  agtcgtaatt acaactttat caagacagaa cggtttgttg gaccaagcga
    9501  atttggtagg gcgatggctg ctgccgttat cgaacgttgt ttcaaaatgg
    9551  aagagatggc taagataagg tgtgatatta tatcccttac cgaggctaac
    9601  attttgaaat ggctcgataa gcgcactcct tgtcaaataa aggcagtgca
    9651  ggctgagttg aagcttccct tttcggtgga ggagcagatt accaactaca
    9701  aactgatggt taaacgtgat gctaaggtaa aacttgatga ctcaagtcta
    9751  tctaaacatc ccgctgccca gaacattatg tttcacaaga agtttattaa
    9801  tgccatattt tccccatgtt tcgatgagtt caaaaataga gtgttgtctt
    9851  cacttaatga caatatcgta ttctttactg aaatgacgaa cgctgggtta
    9901  gcggaagtta tcagaagaat cgttggtgac gacgacaact tattcgttgg
    9951  ggaagtggac ttcagtaagt tcgataaatc tcaggatttg ttcattaagg
   10001  agtacgaacg tacgttatat tccgagtttg ggttcgatac cgaacttctc
   10051  gatgtgtgga tggaaggtga gtatcgcgct agggcgacta ctttggatgg
   10101  tcaactgagc ttttcagttg atggtcaacg tcgttctgga ggttcgaata
   10151  cttggattgg gaattctctg gtcactctag gcattctctc gttatattac
   10201  gacgtttcaa agtttgaatt actccttatt tccggtgacg attctttgat
   10251  ttattcgagt gagaagataa gtaacttttc ttctgaaatt tgcttagaaa
   10301  caggctttga gactaagttt atgtctccga gtgtgccgta tttttgttcg
   10351  aagtttgtgg ttcagaccgg taacaaaacc tgttttgtac ctgaccctta
   10401  taaattgtta gtaaagttgg gggctccaca aaacaagtta accgacgatg
   10451  agttatttga gttgtttact tcttttaagg acataacaca ggactttggt
   10501  gatcaagtgg ttttggagaa attgaagttg ctagtcgaag ctaagtatgg
   10551  gtttactagc ggaactacta tgcccgctct gtgtgccata cattgtgtac
   10601  ggtccaatta tttatccttc gagaggttgt ttccttttat taggggttgg
   10651  tatgtcgtcg atgctttgaa gcttagacaa ctaaggaagt tcgccaactt
   10701  aatttgtgaa cgcatagttt acgataatcg cgtgggttac ttttcgtact
   10751  ttgacaatcc gtttactaaa cccgacgcta gcgatggtca aacggacgac
   10801  ttggtgacta gttgatcgtt tgttcagttc tcgctgagag ccaacgttgg
   10851  tagttgagtc gagatgtttg ccttcgcgag cgaaaaccaa gacttattag
   10901  aagaaaaaat atttcgtcgt agaacgtacc atcgtaagta tttcgatgac
   10951  gtggttaggg atttcactat tgatgttggt tatgacgttg atgatcgtga
   11001  ccctacggtg ttggctgact atttctcgtt gtatttcttt ttgcttaaca
   11051  atgataacgt tgggccttta gcggcttcaa ttgtagtgag cccgccggtt
   11101  agcgggactt ataaaattcg agcacatgtc gataatcaac caaattgcga
   11151  aggaaacgtg acttacgtta agactgccaa taagagtcgt tttgcaattc
   11201  tcgtaaaagc agtcccggct ccaatgagag gttattactc ttttcgggcg
   11251  tttcttaccg ataatgtcac tagcgaacgc agtgaattca tatgcagttt
   11301  tatcggtagt agattccttt gttgttgtac gcaaacgata tccgaaaatt
   11351  tgagtaaggt ttgttcgtcc tctttctctt ttagagcagt ctcagaaacc
   11401  gcgaataacg agtttcctgt tgcgactgat gatgtagaag acatcaagta
   11451  tgtgagaaaa cgagccgagg gtttctcaca ttgcgctgac ccgtaccctc
   11501  ctaggtgtta tcgcggcgct aatttaggcg attcttcagg ggttcaaagt
   11551  cgtacaatcg aagaagaagg ttataggacg gataccgcag gtaacgtcgc
   11601  ggtcactatc ccgaataccc cactagttag tgctgtctct ccgtatgtcg
   11651  cagagtacaa cgaaaatacg cgttcgcgta tctcgttaat acgccgagtc
   11701  tgttgctacg ccgtttgtgt tttagtggtg tctcttctta taatgagcgg
   11751  tttgttagcc attatattca tatgatttga tgtggtaact tacgaggtac
   11801  aattagctaa aactcaccgt ttgactcagt ttaaacgggt ttcaatggac
   11851  tgtgtgattc aaggatttct gacttttctg gttggtatag ctgtgttttc
   11901  agcctttgcc ggactgatta tcattgttat aacgatttat cggtgtacaa
   11951  ctaggcctgt tagaaacacc tctccttacg gcactcacgc cactgtctaa
   12001  gcagtatggt actcctgggt ttagactttg gtaccacgtt ttcgacggtg
   12051  gctatggcta cgtcttctga gttagttata ctcaaacaat ctaattcgtc
   12101  gtatatacct acgtgtttgt ttctgcatgc agatcctaac agcgtgtctt
   12151  atggttacga tgcggaatat ttagcggctt cagggggacc cggctcgttt
   12201  tacaaagatt tgaaacggtg ggtcgattgt actgagaaga attaccaaag
   12251  ctacttgcac aagttgtcac catcttataa ggtgatagtg aaagagtttg
   12301  gagctaagag tatgccggtt ccatatatat cacctttgaa taatgatctt
   12351  gggctcagcg tcgctttacc ttcattgatc gctttataca ccaaatccat
   12401  tttatcggat gcggaaagag tgtttaacgt gagttgtact ggtgttatat
   12451  gttcggtacc tgctggttat aatacgttac agcgagcttt tacgcaacaa
   12501  agtgtatcct tgtcgggtta ctcttgcgtg tatattatta atgaaccttc
   12551  tgctgctgct tactccactt tacctaagtt gagttcggca gataagtatt
   12601  tggccgttta cgatttcggt ggtggaacct ttgatgtttc tatagttagc
   12651  gttagattac ccacgttcgc tgttagaagt tcaggtggtg atatgaactt
   12701  aggcggtaga gacattgata gaaaattatc tgataaaata tatgagttgg
   12751  ctgattttct accgcaaaag gagttgaatg tatctagtct aaaggaagcc
   12801  ttatctcttc aaacggatcc agtcaaatat accgtaacca attatgggat
   12851  tagtgaaaca gtatcaatcg accaaacgac tttgagggag atagcttcgg
   12901  tgtttataac tcgaacggta gacatactta cacaagttaa ggttaagtct
   12951  agtgtgcccg agtcgcaaag tttgaagcta gtggtagtcg gtggaagctc
   13001  gtacctacca gggttgttgg atactttgga aactgtgcct tttgtgtctg
   13051  ggataatacc agtggaagac gcaaggaccg ccgttgctag agggtgcgct
   13101  ttatatagcg agtgcttgga tggtaggtcc aaagccttat taatagattg
   13151  tatcacgcat catttatcgg tcacgacatt tagtgcggac tcggttgttg
   13201  ttgctgcggc cggaagtcca attcctttcg aaggagaacg aaaactcacg
   13251  ctacgtaagt gcgttagtac gtctaattat caagcgagga tgttcgaagg
   13301  agattacgaa aaggttttcc gaaacgagcg tatatacgca gcttcggtat
   13351  cattgtttac tttaggagtt aactggcgct tgcccaatga cgttgagatg
   13401  actctcgtga ccagagtgga ctcaatgggt aaagtggaat tctaccctaa
   13451  aggtccatct ggtgagttag ttaacgtgca aggtacttca cattatgatt
   13501  atgttggtat gcctcgtcct accaggaagt tgttgaggct tagcgattac
   13551  aatgtaaact ccgcagcttt agttttagct ttgacgttga ctcgcgaaaa
   13601  acgagaaaag tttcttttgc gaacgttatt tgatgcttta ctagcagact
   13651  tacgaaagac cgcaagctta agcgaatatt ctaagaaata cccgatcact
   13701  cgaaacgacg tcgatgtcgt ctcatcacgt atggggatcg ttgtttcgaa
   13751  agttttacgg ggaagcgatt tggaaagaat acctctctga atcaactcga
   13801  aatttcgatg agggaaacgt gtcgttggac cacactctga gttcgggtgt
   13851  ggtcgtccgt aggcagagtc ttttgaacgc acctcaaggg actttcgaga
   13901  acgagttagc actattgtac aattcggtgg tgattaatga cttcgttgag
   13951  ttcactggta tgccgttgag gtccttgatg acgggtatcg aggaccgtaa
   14001  ggtgcctgac gagttaatat ccgttgaccc gcatgaagtt ggatgtaaat
   14051  ttacgttaaa tgatgtggaa tcatatctaa tgagcagggg tgaagattcc
   14101  gctgatgtga cggcggtcga gcactcgtgg tgtttgagta attcttgcgg
   14151  tagattatta agttcgactg agatagatgc ttacaaaacc atgatgttta
   14201  ctaagagttt cgatagtagt gtatctgggg tgattactaa attacagact
   14251  tatttatcgt actgcatatc gttgtacaag aaacattgca tgaaagacga
   14301  tgattatttc aatcttatct tacctatgtt taattgttta atgaaagtgc
   14351  tggcttcgct agatttgatt gatgaaaaac ttactgacca tgcgctgctg
   14401  accggcatgc tcatagagtt ttgcctagaa aataaggtgt attactctac
   14451  ttttaaatac aatttagaca acgttagatt gtttaagtct aaagtgttgc
   14501  ctgtggtgtt aacggtttgg gatatatctg agcctgacta cccgatggat
   14551  gaaagggggc taattccttt cgatcctacg gatttcgtgc tcgatttacc
   14601  taaactgaat atacacgaca caatggtggt ggtgggtaat caaatcagac
   14651  agttagagta cgtagtcgag agcgatgctt tagacgattt atctcaacac
   14701  gttgacatac gtttagcagc ggacaacccc gatttacgcg ttgatctgcg
   14751  ttgggcaggg atgtttgtct actacggtgt ttatcggtgt gctattgata
   14801  gagtggtaga acgaccgacg ttatttagat tgccgcagaa gttactgaat
   14851  caggatgatg gcgaatcgtg ctcattacgc atgagtgccg tcgaagcttt
   14901  gtttaatcta gtgcaaaagg tgaacaggga cataaacgtt agacgtcagt
   14951  tcatgggacg tcacagtaaa gtggctttgc gactgtatcg caacttaggt
   15001  ttgaggtttc caccgatctc ttcagttagg ttaccggttc atcacggtta
   15051  tttatacgtc gatttttaca aaagagtacc tgacgatgct gttactgccg
   15101  acgaactcga aagtttgcgt caattgcgtt cgtccgtgga cgttatgtgt
   15151  aaggacagag tgtcaatcac acctccaccg ttcaatcgac ttagaagagg
   15201  ttcttccaga atatttagag gtcgaggcgc acgcggtgcg agctcgcgtc
   15251  atatgagcag agacgtggcg acttccggtt ttaatttacc ttatcatggc
   15301  aggttacaca atgcttccta ataccgaaga caaagaaatg aatccggtga
   15351  gtgccgctgt gcccggtaag tatccggatg tcattgagaa atttgtgacc
   15401  aataggtccg tagacgcgtt aatagaaggc gttataagta agctggatac
   15451  taattcaata tacgaagatt ccactgaaaa atttactggt gaatacttga
   15501  aatacgttat ggttactatg gatactttct tattagaaaa ctacaagacg
   15551  aaaacggaag atctgttggt tcacctagct atgatccaaa agaggttgtg
   15601  cactatatcc acgagcacta aaaccaagtt ccgcgataaa ggttgtatta
   15651  gttacgtgca agggggttcg cgatataagt taatggataa agtagttttt
   15701  cctttcatta tatcgaaatt taccgatagg gagactccga acgctctacg
   15751  taagtacgct tgcactttcg aggagttgca cttgtgtatg gctaggttga
   15801  gacccgactt atacgaaaat aaaaggacga ccaaagccgg gactccacat
   15851  ttaaagggct acttatcagc cgactttctt tcgggttctc tcccagggta
   15901  ctccgaacat gaacgaggca tcattcttcg agcgtctgag tctatgttag
   15951  ctagacgtca aggttacgag gaggcgaccg agcttcttaa cctacgtgat
   16001  ttgggtaagt acttgtagtt ggtttgggga cggtaatatt ataccatcct
   16051  ttgagcgctg ctttaaggat cgttaattga cgactcttga tatatttact
   16101  agattcgaat tatggacgac gaaacaaaga aattgaagaa caaaaataag
   16151  gaaacgaaag aaggcgacga cgttgttgcc gctgagtctt ctttcggttc
   16201  cttaaactta cacatcgatc caactctgat agcgatgaat gacgtgcgtc
   16251  agttgggtac ccaacagaac gctgctttaa acagagactt gtttcttact
   16301  ttgaaaggga agtatcctaa cttacctgac aaagataaag actttcacat
   16351  agctatgatg ttgtatcgct tagcagttaa gagttcatcg ttacaaagcg
   16401  atgacgacac tacgggcata acgtacactc gggagggtgt tgaagtggat
   16451  ttgtccgaca aactttgggc tgacgtcgtg tttaactcca agggtattgg
   16501  cgaccgtact aacgcccttc gagtttgggg tagaactaac gatgcccttt
   16551  acttagcttt ttgtagacag aatcgcaatt tgagttatgg tggacgtccg
   16601  ttagatgcag ggattccggc cgggtatcat tacctgtgtg cagatttctt
   16651  gaccggagct ggcttgactg atttagaatg tgctgtgtac atacaagcta
   16701  gagaacaatt gttgaagaag cgaggagctg atgaagtcgt agttaccaat
   16751  gtcaggcagc ttgggaaatt taacacacgt tgatctgttg cgttccgatt
   16801  cccggtttct atcgggatgg tggagcttca tcgtgaacgt gggtgatata
   16851  atagtccggt ttgcgttaca cgttcctaat gaagatatgc tgaatagttt
   16901  ttcagctgta tcgaattgta cgatcatagc agacagtagt gctttactaa
   16951  aagacaatac cgtggttgat cgtttagaag gcacgaatcc tttggcttat
   17001  ttgttaaatt tagcgaaaac gactactact atttgtttta ctatgtctaa
   17051  taaggttctt tttggtacta ctaaatctga accacttagt tgtttagcta
   17101  ttgcgtcaga tcgagttttg ttcaaagtta ttatgggtac taacgttgat
   17151  gattctcgat gcggctgcag tatttggttt tacaacaatg gtacgtttca
   17201  aaacggattg atccgttgta ataatctcgt cgctttgttt agcgcgactt
   17251  agacacgaag tgaccgttcg gatttaatcg ctgcaatgag ctttcgacgc
   17301  atgtggttaa aggttatggc tgtagttacg gtattatggt acggtaaaga
   17351  accttccatt agtgaaggtt acaatgctct tatgaatgat gactttaaat
   17401  ttatcgatac gcacttttca aacgtttctt atgctaagaa atgttacgat
   17451  ttggctaatt tcgatttaga ctttctacgc atcgttatca ttcctttgag
   17501  tggtggtacg gtgaatgaat cgcgtgctaa tcccactaac gtctcagaga
   17551  ttgtcgagtc gcatatgagc gaccgagaca gaatgagcat cttattgcgt
   17601  aataagcgga tccaaattcc ttcgctcttg ccttgcggcg actagagtct
   17651  actcagtagt acgtctacta gtataacgta ttaaacactt tagtaaagag
   17701  ttttgtttaa gctgaacaat atgcgagctt actttagtgt taacgattac
   17751  ataagccttt tggctaaggt tggcgcagtt gtggaacgtt tatgcgatcc
   17801  cagcgtaact ctcacggaag tgatggatga aattaatgac tttaactcat
   17851  tcctcgcttt ggtgcactct atgaagtcgg acatgaacgg agaccatcag
   17901  gatggtcacc atgagatggg tgaacacaag tctcggttgt tgtgcaatat
   17951  agaggcgaaa ctgcgagtac ttctcgatat cataagacgt cggttcactc
   18001  gcgaaaaact gctctgtacc agtgccacag atgtcatggg cttcttcgtc
   18051  gtgaggtaca tgagttctag tcacaccagt ttcgagtccg taatgcatac
   18101  ggaattgaag ttagtggtta aggcggtgct gtcagatctg tcccgcacgc
   18151  ataaactaga ttttagcgag cgagcctttg cggcttacgc tatcctttta
   18201  caaaagggtg ctgtggcaac cgtttgtagt cagtttgaca ttaatttagt
   18251  ttctccgtct tgcgtgtagg ttaatacgct tctcagaacg tgtggttgca
   18301  ttaaccaact ttaattggaa caaatttatt gtttaaagtc tgtgagttac
   18351  gatggacgat actagcggac aaactttcgt ttctgtgaac ctttctgacg
   18401  aaagcaacac agcgagtact agagttgaaa acgtaaaatc ggaagcggat
   18451  cgcttggagt ttttacgtaa aatgaatccc ttcattattg acgctctggt
   18501  gcggaaaact aattatcagg gcgctcgctt tcgtgcgaga ataataggag
   18551  tatgcgtgga ttgcggtaga aaacacgaca aggcgctcaa gactgaacgt
   18601  aagtgtaagg tcaacaatac gcagtctcag aacgaggtgg cgcatatgtt
   18651  gatgcacgat cccgttaagt atttaaacaa aagaaaggct agagcctttt
   18701  ctaacgcaga gacgtttgcg attgaactgg ttttgtacac caaggaaaag
   18751  caattggcgg ttgatttggc cgccgaaagg gagaagacga ggttggctcg
   18801  tagacaccca atgcgttctc cagaggaaac tccggaacat tataaattcg
   18851  gtatgactgc taaagcgatg ttaccggaat tcaacgctgt aggcgttggt
   18901  gataacgaag acacttcgtc ggaataccca gtaagtctga gtatttccgg
   18951  tggagttctc cgtgaacacc acttcatctg attgaagtgg acggaataag
   19001  ttccttgcgg aactttatat cgggttggta agaaccctta tgatggtgat
   19051  atatcactag acaataaccg gatgggtaaa gtctttaaaa tgatcgaggg
   19101  gaaagattaa ccgtatcctc tcgttggtct aagctcccac agagtggtag
   19151  tggtctcaag tgaggcttaa cgtatgtgtg aaccaaagaa gttctcctca
   19201  gagtgtgtgt tgtttaccca acacactgtc cctatggggg gccaacatag
   19251  gtcca