Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate NZRB-TH30, complete genome.

ACC No: FJ525434

Dated: 2010-04-07 | Length: 19270 | CRC: 544596118

                
ID   FJ525434; SV 1; linear; genomic RNA; STD; VRL; 19270 BP.
XX
AC   FJ525434;
XX
DT   08-FEB-2009 (Rel. 99, Created)
DT   07-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate NZRB-TH30, complete genome.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-19270
RX   PUBMED; 20352212.
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   "Isolates of Citrus tristeza virus that overcome Poncirus trifoliata
RT   resistance comprise a novel strain";
RL   Arch. Virol. 155(4):471-480(2010).
XX
RN   [2]
RP   1-19270
RA   Harper S.J., Dawson T.E., Pearson M.N.;
RT   ;
RL   Submitted (04-DEC-2008) to the EMBL/GenBank/DDBJ databases.
RL   School of Biological Sciences, University of Auckland, 3A Symonds Street,
RL   Auckland 0630, New Zealand
XX
DR   RFAM; RF00193; CTV_rep_sig.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .19270
FT                   /organism="Citrus tristeza virus"
FT                   /host="Poncirus trifoliata"
FT                   /isolate="NZRB-TH30"
FT                   /mol_type="genomic RNA"
FT                   /country="New Zealand"
FT                   /collection_date="03-Jul-2005"
FT                   /note="resistance-breaking genotype: RB"
FT                   /db_xref="taxon:12162"
FT   5'UTR           1. .107
FT   CDS             108. .9473
FT                   /codon_start=1
FT                   /product="p349 protein"
FT                   /db_xref="GOA:B9VB44"
FT                   /db_xref="InterPro:IPR002588"
FT                   /db_xref="InterPro:IPR008749"
FT                   /db_xref="InterPro:IPR022054"
FT                   /db_xref="InterPro:IPR022108"
FT                   /db_xref="InterPro:IPR022239"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB44"
FT                   /protein_id="ACM49886.1"
FT                   /translation="MSKLRGSFWSSAIAVNSDYTISRIWRKLNTIIVLHYFGSVRITKV
FT                   IRDKSADMPIAPLRKSVFPFSVRAAVRAIRAAGRPLDAPHSGCLCGLPVFNASGVVSPR
FT                   SVAGFSRFSLCKPPLTSAAKRSLRQAKRESVSLSSRASSRFSREVPCGTRSRLRRRVVG
FT                   RADTAPAESPQDKPTRRNSRLGKTSHLPYMGEAALDDILRWIEGVNPHPSMVAIPVPIN
FT                   FGTMTTTAWCSRSEAAVLRCRLDYHAAETDFSTQEKHIRYVYNDVSSAANRPRTVSPRK
FT                   CGSVFPSKSKLGVEVPSGRDLHTAFVRSSRASAFFSDAVRRVRLFRPARNNFFTSVVSG
FT                   RRVCYYRPGPCGTVSVLMSDGVNTARLDVVAPAYYAYAKSLGAKVRFLWESSDLDDAKV
FT                   RDGQCYVRHVFDVALYFGRRADLSVRRALGMYPTVGALKAYLVREYGRDSLKVPMRGTY
FT                   TFGSVFHCLSTKSSVDLRSIPNHHLVGGTPAHVLIGQVRVSIPGSIVKPSRSVVRRRNR
FT                   RMRCDGFLGSSSSSSSAGESTYCSDCSSPRSLPSPSVLKPSLGRIPSIDRRFRFPAGTQ
FT                   LRVSVPRRVDDHVYVSTGSNFDELCHAVCSYVKRYNSRKSFYTRFESGRDYVVLRRASV
FT                   GGLHVFVKRGNFTARFPISAVRYENHYAAVMMDVGTRWVPKDCVPDVEIVKLRRSRNRR
FT                   FPPSHHAVDQSVPALQPSPVEVASVSSDKPSSSQKASSPSSSSSSFNSIKSSDWVNVGF
FT                   SHRTTNKVREPRSAGHGRIGNFTFPRGTVYNTPVDERAYKRVLRLRDTTACSFLRILLA
FT                   RLSSYRPLSDEFFNKCVTSRFVACIEPVQTGLVKVHFRSDVFRASFPFGVKLYTHHAFD
FT                   IGSGGLLGLDNYGLSESLKDGYCYIRHFAEVSLSMGRIFFRRDVDLGPFPHVFEVQHRL
FT                   ERLYGKAALGYGVRGHYSAPRCFHCCYNDSPRPMASFNSYHKMGGEDNSLIITDTDRLR
FT                   AVGSAYEKVKRNIPDSLLVRSVEKDLIEFNQTLVDMHRSRPGVVVPFQMSENQQVMLTR
FT                   AYPEFNINFIHSVHSDHPVAAGSRALENHLVRKHAGTDYSDVGGCPLFHLRAGHSGVHV
FT                   CRPVYDVKDAHRRVVRHHQLNKVSLDQSDGVKQVGAVNTNSVCGNILGECYHASEAIVM
FT                   VQVYDVPLHELCRAMINKKTSVCYMTMVTPGELLDARESFFIKDLDCSVELDPVADQVV
FT                   YCFNNSAYTHKYSTICEYMRTPCLVVDGFLFTIEMVSLRCSVNYYCITKSSVSPRISEA
FT                   KRLRYRRCDSDLIRIKIPRYSSKTRSCLPGCYYLYLDAKFVSRVYEYVVNNCVVVNAKT
FT                   FEWTWNYIKSCKSRVVISGKIIHRDVPIALEYLDGFSAVMLSAGVKGRQNAEAFSRRLA
FT                   AFSGDTSIFELVRFTISEKCRDLFMGIQDAVERCVKSYLRNSFNMSFVDLSDPLLTISE
FT                   YSELDVPINLPGFGRIVDGDETRLMEDGVKSALLRKAVRDEAQLNLKRGNTSEIVPCED
FT                   DDDSNDDDSRVSRDSDGSSPSGGSSGGLRAGAAPSLFRSLLRKLGGGLCLAKKVLELLL
FT                   KRVVESFSRLKRKTTRLTSFANLLLARLSCGFFDDSVFSAVWEIAVNLTRIIDGVVKTK
FT                   LECFRNLFRLIPKLYVGCRDVVKDVSNAYRSAVLFSAEIFGKSYSKLCQFCLETFDVGL
FT                   IEISARNLGLETCVSMAQAIFDVLVTFPLGSVSFSVVCARVFGALAMEVGSNFLFKKVF
FT                   GKPETLGEDAFRRTVSMVLSAKAFDKLSVDAKGLVRCSGVIPGVLRIILSSLFSEADAW
FT                   VGYSKHEVSSLPIVTFCVKKLSYSLEQCKEVCIAFVVDSAKKILKSLTSEFNESIQNSD
FT                   LTSGAKSLYGHVSSILSTSSGVISKAGNAVATVKAVGSDIGGRVKRLRPRFSLSRHFDE
FT                   QTSEYYSASDCSELDESLLSETPGLRGNGRCRDLFRIVSRRMVACSEYLINLLKQLTSR
FT                   ASEYSYSYVMDLLVRLCVATDDVVRRCRSFTFDCADKASDFIVGCLSWYNLRSGAYSAT
FT                   PGLGGGSRSLTTVFPTGGFVRVIGALGNVLSVVFDEEFFRTLLHRLRTDVVVLLVEFLK
FT                   NLPVCLFSVYTFFECRGRVFPLREFLWGFCRLVWEIVEGLSINVYQHLSAVVVRAYRCA
FT                   FNQRFYEEDERTLRVITEAEGRIEFLRVVLAEMERFRAASNEMSLSRSSDSPSFPPTYG
FT                   EIVELNDDSSDSALVIGVDNGTGRAIVDSETDSASGSDSDVSIPLDRDFEQIGGLGGNG
FT                   NVDVFRLGLRFTLKLLRNLFNARSFKVLYGLLLQTLFYGGSVNKFVSRLVFSLGTCLPF
FT                   ELFRFACSARRLFKSLALFVYQANLFSEATVEHLFSFSRLLYDSRYFSSVFSEIERFDF
FT                   YLDHFLSLPMRYLFPNSRVRGCTRAPVLVTRTEEVTPDCKRSLNDILDSLDSLKVSDLK
FT                   GKSTFVDDEESGSGSERSGSSISFGSINEEVLNAVNGDGVCEKAPLMKHATALSKLEPD
FT                   PSGRKDIPVSKKTFTRGECSGVKSKVGLCDYLVTLNSSFGTVPDMYPVARDITYKKLTN
FT                   AMREFYYSQKITLYELHGKLSSYWDELKVAGFDRKLTKMDLDDDVYVVDFNRKLLVGRN
FT                   GSHPFRGTLKSYCFMFCNDGLVPCPGSQKYDYALISNQTSFVAANSFLRAVDGKDLTFT
FT                   NEGHSLIVYEAPPGGGKTHSLVNCYADYCDKVSCLVVTANKNSQTEISQRVSSELMSRK
FT                   RSAKYVTGAASRVFTVDSYLMNHLRLTTQLLFVDECFMVHAGAIGAVVEFTSCKAVVFF
FT                   GDSKQIHYIHRNDLGVSLLHDIDAFIQPEHHIYGEVSYRCPWDICEWLSEFYPRHVATT
FT                   NVGSVGKSSVSIEEINGCDDVPYDKAAKYIVYTQAEKNDLQKHLGRLTVGRTKVVPIVN
FT                   TVHEVQGETYKRVRLVRFKYQEDTPFSSKNHIVVALTRHVDSLVYSVLTSRRYDDTATN
FT                   IDRAKEIFDKFRSTNHSYGSSSLEWYLEKFPTEYKGSKASSAPISCINEFLNEVVVGSS
FT                   VVQLGDVSEELSSRPFESGCDNVTVRDTAPPDSGNLHEPARVRRSKVTSNSSKKSVATR
FT                   KPSVVRKS"
FT   CDS             <9397. .10830
FT                   /codon_start=1
FT                   /product="RdRp protein"
FT                   /note="start codon not determined; likely expressed by +1
FT                   ribosomal frameshift"
FT                   /db_xref="GOA:B9VB45"
FT                   /db_xref="InterPro:IPR001788"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB45"
FT                   /protein_id="ACM49887.1"
FT                   /translation="GVVRSQAIPPRKASLQENLLSYESRNYNFIKTERFVGPSDFGRAM
FT                   AAAVIERCFKMEEMAKIRCDIISLTEANILKWLDKRTPCQIKAVQAELKLPFSVEEQIT
FT                   NYKLMVKRDAKVKLDDSSLSKHPAAQNIMFHKKFINAIFSPCFDEFKNRVLSSLNDNIV
FT                   FFTEMTNAGLAEVVRRIIGDDDNLFVGEVDFSKFDKSQDLFIKEYERTLYSEFGFDTEL
FT                   LDVWMEGEYRARATTLDGQLSFSVDGQRRSGGSNTWIGNSLVTLGILSLYYDVSKFELL
FT                   LVSGDDSLIYSSEKISNFSSEICLETGFETKFMSPSVPYFCSKFVVQTGNKTCFVPDPY
FT                   KLLVKLGAPQNKLTDDELFELFTSFKDITQDFGNQVVLEKLKLLVEAKYGFTSGTTMPA
FT                   LCAIHCVRSNYLSFERLFPFIRGWYVVDALKLRQLRKFANLICERIVHDNRVGYFSYFD
FT                   NPFTKPDASDGQMDDLMTN"
FT   CDS             10879. .11790
FT                   /codon_start=1
FT                   /product="p33 protein"
FT                   /db_xref="InterPro:IPR010803"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB46"
FT                   /protein_id="ACM49888.1"
FT                   /translation="MFAFASENQDLLEEKIFRRRTYHRKYFDDVVRDFTIDVGYNVDDR
FT                   DPTVLADYFSLYFFLLNNDNVGPLAASIVVSPPVSGTYKIRAHVDKQPNCEGNVTYAKT
FT                   VDKNRFAILIKAVPAPMRGYYSFRAFLTDNVTSERSEFICSFIGSRFLCCCTQTISENL
FT                   GKVCSSSFSFRAVSETAINEFSVATDDVEDVKYVRKRAEGFSHCADPYPPRCYRGANLG
FT                   DSSGVQSRTIEEEGYRTDTAGDVAVTIPNTPLVSAVSPYVAEYNENTRSRISLVRRVCC
FT                   YAVCVLVVSLLIMSGLLTIIFI"
FT   CDS             11860. .12015
FT                   /codon_start=1
FT                   /product="p6 protein"
FT                   /db_xref="InterPro:IPR009584"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB47"
FT                   /protein_id="ACM49889.1"
FT                   /translation="MDCVIQGFLTFLVGIAVCSAFAGLIIIVITIYRCTTKPVRNTSPY
FT                   GTHATV"
FT   CDS             12021. .13805
FT                   /codon_start=1
FT                   /product="p65 protein"
FT                   /db_xref="GOA:B9VB48"
FT                   /db_xref="InterPro:IPR001023"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB48"
FT                   /protein_id="ACM49890.1"
FT                   /translation="MVLLGLDFGTTFSTVAMATSSELVILKQSNSSYIPTCLFLHADPN
FT                   SVSYGYDAEYLAASGEPGSFYKDLKRWVGCTEKNYQSYLHKLSPSYKVIVKEFGAKSMP
FT                   VPYLSPLNNDLGLSVALPSLIALYTKSILSDAERVFNVSCTGVICSVPAGYNTLQRAFT
FT                   QQSVSLSGYSCVYIINEPSAAAYSTLPKLSSADKYLAVYDFGGGTFDVSIVSVRLPTFA
FT                   VRSSGGDMNLGGRDIDRKLSDKIYELAEFLPQKELNVSSLKEALSLQTDPVKYTVTNYG
FT                   ISETVSIDQTTLREIASVFITRTIDILTQVKVKSSMPESQSLKLVVVGGSSYLPGLLDT
FT                   LETVPFVSGIIPVEDARTAVARGCALYCECLDGRSKALLIDCITHHLSVTTFSADSVVV
FT                   AAAGSPIPFEGERKLTLRKCVSTSNYQARMFEGDYEKVFRNERIYAASVSLFTLGVNWR
FT                   VPNDVEMTLVTRVDSMGEVEFYLKGPSGELVNVQGTSHYDYVGMPHPTRKLLRLSDYNV
FT                   NSAALVLALTLTREKREKFLLRTLFDVLLADLRKTASLSEYSKKYPITRNDIDVVSSRM
FT                   GIVVSKVLRGSDLERIPL"
FT   CDS             13729. .15336
FT                   /codon_start=1
FT                   /product="p61 protein"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB49"
FT                   /protein_id="ACM49891.1"
FT                   /translation="MSSHHVWGSLFRKFYGEAIWKEYLSESTRNFDERNVSLDHTLSSG
FT                   VVVRRQSLLNAPQGTFENELALLYNSVVINDFVEFTGMPLKSLMIGIEDRKVPDELISV
FT                   DPHEVGCKFTLNDVESYLMSRGEDSADVTAVEHSWCLSNSCGRLLSSTEIDAYKTIVFT
FT                   ENFDSSVSGVTTKLETYLSYCISLYKKHCMKDDDYFNLILPMFNCLMKVLASLGLFYEK
FT                   HTDNPLLTGMLIEFCLENKVYYSTFKVNLDNVRSFKSKVLPVVLTVWDISEPDDPVDER
FT                   VLIPFDPTDFVLDLPKLNIHDTMVVVGNQIRQLECVVEGDALDDLSQHVDIRLAADNPD
FT                   LRVDLRWAGMFVYYGVYRCAIDRAVERPTLFRLPQKLLSQDDGESCSLRMSAVEALFNL
FT                   VQKVNRDINVRRQFMGRHSKVALRLYRNLGLRFPPISSVRLPVHHSYLYVDFYKRVPDD
FT                   AVTADELESLRQLRSSVDVMCKDRVSITPPPFNRLRRGSSRTFRGRGARGASSRHMSRD
FT                   VATSGFNLPYHGRSYNTS"
FT   CDS             15311. .16033
FT                   /codon_start=1
FT                   /product="p27 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB50"
FT                   /protein_id="ACM49892.1"
FT                   /translation="MAGHTILPKIDDKEMDPVSAAVPGKYPDVVEKFVANRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEYLKYVMVTMDTFLLENYKTKTEDLLVRLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGSRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLSGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
FT   CDS             16127. .16798
FT                   /codon_start=1
FT                   /product="p25 protein"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB51"
FT                   /protein_id="ACM49893.1"
FT                   /translation="MDDETKKLKNKDKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFST
FT                   R"
FT   CDS             16764. .17267
FT                   /codon_start=1
FT                   /product="p18 protein"
FT                   /db_xref="InterPro:IPR008452"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB52"
FT                   /protein_id="ACM49894.1"
FT                   /translation="MSGSLGNLAHVDLLRSDSRFLPGWWSFIVNVGDIIVRFALHVPNE
FT                   DMLNSFSAISNCTIIADGSALLKDNTVVDRLEGMNPLAYLLNLAKTTTTICFTMSNKVL
FT                   FGTTKSEPLSCLAITSDRVLFKVIMGTNVDDSRCGCSIWFYDNGTFQNGLIRCNNLVAL
FT                   FSAT"
FT   CDS             17301. .17660
FT                   /codon_start=1
FT                   /product="p13 protein"
FT                   /db_xref="InterPro:IPR009692"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB17"
FT                   /protein_id="ACM49895.1"
FT                   /translation="MSFRRLWLKVIAVVTVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGTVNESRANHANVSEIVESHISDRDRMSILL
FT                   RNKRIQIPSLLPCGD"
FT   CDS             17736. .18284
FT                   /codon_start=1
FT                   /product="p20 protein"
FT                   /db_xref="InterPro:IPR021742"
FT                   /db_xref="UniProtKB/TrEMBL:Q1X8W8"
FT                   /protein_id="ACM49896.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   AVATVCSQFDINLVSPSCV"
FT   CDS             18367. .18996
FT                   /codon_start=1
FT                   /product="p23 protein"
FT                   /db_xref="InterPro:IPR006893"
FT                   /db_xref="UniProtKB/TrEMBL:B9VB55"
FT                   /protein_id="ACM49897.1"
FT                   /translation="MNDTSGQTFVSVNLSDESNTASTRVENVKPEADRLEFLRKMNPLT
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDRALKTERKCKVNNTQSQNGVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKEKQLAVGLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGMTAKAMLPELNAVGVGDNGDTSSEYPVSLSVSGGVLREHHFI"
FT   3'UTR           18997. .19270
XX
SQ   Sequence 19270 BP; 4702 A; 3817 C; 4842 G; 5909 T; 0 other;

fj525434 Length: 19270  07-APR-2010  Type: N  Check: 1125  ..

       1  aatttcacaa attcaacctg ttcgcccaga aaatacgtct ggcacaacag
      51  ggatccggaa taggtccagc ctttaagctc taatattccc acaacaaaaa
     101  ttaaactatg tcgaaactca gaggaagctt ctggtcttcg gccatcgctg
     151  ttaacagcga ttacacgata tcgcgcatct ggcgcaaact taacaccata
     201  atagtcctgc actattttgg ttctgttaga atcaccaagg tgattcgtga
     251  caaatcggct gatatgccga tagcccctct acggaaatct gtatttccgt
     301  tttctgttcg cgcggctgtc cgcgcaattc gtgctgccgg gcgtcccctt
     351  gacgctccgc attcagggtg cctctgtggc ctccccgttt tcaacgcatc
     401  tggcgttgtt agtccccgct ctgtcgcggg tttttcgagg ttttctctgt
     451  gcaaacctcc gctcacctct gccgctaaga ggtccctccg tcaggctaag
     501  cgggaatctg tttccctttc tagccgggcc tcttctcgct tctctaggga
     551  agtcccttgc ggcacacgtt caagacttcg cagacgtgtg gtgggacgag
     601  ctgacactgc cccagccgag agtccccaag acaagccaac ccgaagaaac
     651  agccgacttg gtaagacttc tcacctccct tacatggggg aggcagcgtt
     701  ggatgatatc cttcgctgga tcgaaggggt taatcctcat ccctcgatgg
     751  tcgctattcc agtgcccatc aattttggaa ccatgactac aacggcatgg
     801  tgttcccgtt ctgaagccgc agttttgcgg tgccgccttg actatcacgc
     851  ggctgaaact gacttctcca ctcaggagaa acacatacgg tacgtctata
     901  atgacgtatc ttctgccgct aaccgtcctc gtacggtttc tccccgcaaa
     951  tgcgggtctg tttttcccag taaatctaaa ctgggcgttg aggtcccctc
    1001  tggtagggac cttcacactg cgttcgtgag atcttctcgc gccagcgctt
    1051  tcttctctga cgcggttcgc cgcgttcgtc tgttccgccc ggcgcggaac
    1101  aattttttca cttccgtcgt cagcggacga cgcgtttgct attacagacc
    1151  cggtccgtgt ggtacggtgt ctgttttaat gtcggacggt gttaacacag
    1201  cacgtctcga cgttgttgct ccggcgtact atgcgtacgc taaatcttta
    1251  ggcgccaaag tgcgcttttt gtgggagtcg tccgacttgg acgacgctaa
    1301  agtccgtgac ggtcaatgtt atgtccgtca tgtgttcgac gtggctctct
    1351  actttgggag acgcgccgac ctttccgtgc gtagagcact gggcatgtac
    1401  cccacagtgg gtgcattaaa agcttatctt gttcgcgagt acggtcgcga
    1451  ttctcttaag gttcctatgc gtgggaccta cacttttggc agcgtgtttc
    1501  actgcctgtc gactaagtct tcagtcgact tgcgatctat tcctaaccat
    1551  catttagttg gtgggacgcc tgcccatgtt ttaatcgggc aggttcgagt
    1601  cagtattcct ggctcaattg ttaaaccttc acgttcagtc gttcgtaggc
    1651  gtaatagacg catgcgatgt gatggttttc tcggtagttc cagttcttct
    1701  tcttctgcgg gggagtcgac ttactgttcg gactgctctt ctcctcgcag
    1751  tttaccatct ccttccgttt taaaaccttc cctaggtcgg atcccgagta
    1801  tagatcggcg gtttcggttt cctgcgggta cgcagttgcg cgtctccgta
    1851  cctaggcggg tcgatgatca tgtttacgtg tcgactggta gcaacttcga
    1901  cgagttgtgt catgcggttt gctcgtatgt caaaaggtac aactctagga
    1951  aatcctttta cactcgattc gagagcggaa gggactacgt ggttttgcgg
    2001  cgtgcttccg ttgggggtct tcacgtgttt gtaaagcgtg gcaactttac
    2051  tgcccgattt cctatttcgg cggttaggta tgagaatcac tatgccgcgg
    2101  ttatgatgga tgtggggact cgttgggttc cgaaggactg cgttcccgat
    2151  gttgagattg tgaaacttcg gagaagtcgt aatcgtcgtt ttcctccttc
    2201  ccatcatgcg gtggatcagt cggtccccgc gttgcagccg agtcccgtcg
    2251  aggttgcttc ggtttcgagt gataagcctt catcgtcgca gaaggcttct
    2301  tcaccttctt cttcttcttc ttcttttaac tcgataaaga gttcagactg
    2351  ggtgaatgtc ggtttctctc atcgaactac taataaggtt cgtgaaccgc
    2401  gttctgctgg tcatggtagg atcggaaatt ttactttccc gaggggcact
    2451  gtgtacaaca cacctgtcga tgaacgcgcc tataaacgtg ttcttagatt
    2501  gcgagatacc acagcctgtt cctttctccg catactgctg gctcgtttgt
    2551  cgagttacag acctttgagt gacgagttct ttaacaagtg cgtcacttcc
    2601  cggtttgtcg cgtgcattga acccgtgcaa acgggtctcg ttaaggtgca
    2651  tttccgttct gatgttttcc gtgcctcttt cccgtttggg gtcaaactat
    2701  acacccacca cgcgtttgac attggaagtg gtggtctttt gggattggat
    2751  aattacggcc tttcagaatc cctgaaggat ggatattgct acattcgcca
    2801  tttcgccgaa gttagtttga gcatggggcg aattttcttc aggagggacg
    2851  tcgacttggg acctttccca cacgttttcg aagtgcaaca ccgtcttgag
    2901  aggttgtacg ggaaagctgc gttagggtac ggtgttaggg gtcactattc
    2951  agccccacgc tgttttcact gttgctacaa cgattcaccg agaccgatgg
    3001  cgtcctttaa tagttaccat aagatgggtg gtgaagataa ctccctgata
    3051  atcacggata ccgacaggtt gcgtgctgtg gggagtgcct atgaaaaagt
    3101  gaagagaaat ataccagatt cgttattggt tcggtctgta gaaaaggacc
    3151  ttatagagtt taatcagact ctagtcgaca tgcatcgatc cagaccgggc
    3201  gttgtcgtac ctttccaaat gagtgagaac cagcaagtga tgcttactag
    3251  ggcgtacccg gaatttaata ttaattttat tcactccgta cattccgatc
    3301  atccggtagc tgcgggttct agggcgttgg agaatcatct cgttcgtaaa
    3351  cacgctggta ccgattattc ggatgtaggg ggttgtccgt tgtttcattt
    3401  acgcgcgggt cactccggtg ttcatgtttg tagaccggtg tacgatgtta
    3451  aagacgctca ccgtagagtg gtccgtcatc accaacttaa caaggtttcg
    3501  ctagatcaga gcgacggtgt taaacaagtt ggtgcggtaa acacgaattc
    3551  cgtgtgcggt aacattttgg gagaatgtta tcatgcatcg gaggcaatag
    3601  ttatggttca agtttatgac gtaccgctac atgagttgtg tagagctatg
    3651  ataaacaaga aaacttccgt gtgttatatg accatggtta cgcctggtga
    3701  gttgttggac gcccgtgagt ccttttttat taaggactta gattgttcgg
    3751  tcgagttgga tcccgtcgcg gaccaggtcg tttactgttt caacaattcc
    3801  gcgtatacac acaagtactc cactatatgt gagtatatgc gtactccttg
    3851  cttggtggtg gatgggtttt tgtttactat tgaaatggtg tcgctcaggt
    3901  gtagtgttaa ttactattgc atcactaaat cgtcggttag tccgagaatt
    3951  agtgaggcta agcggttacg ctaccgtcgg tgtgacagcg acttgatcag
    4001  aatcaagatt ccccggtact ctagtaaaac ccgtagttgt ttacctgggt
    4051  gttactattt gtacttggac gccaagttcg taagtcgcgt atacgagtac
    4101  gtggtcaata actgcgtcgt ggtgaacgca aaaacttttg agtggacttg
    4151  gaattacatc aaatcttgca agtcgagagt ggtgatcagc gggaagatta
    4201  tacaccgaga cgttccaatc gctttagagt acttagacgg tttttctgct
    4251  gttatgttgt ccgctggtgt gaagggtagg caaaacgcgg aagcgttttc
    4301  tagacgctta gctgcttttt caggtgatac ttcaattttt gagttagtga
    4351  ggtttactat ttccgagaag tgccgcgact tattcatggg cattcaggac
    4401  gctgtggaaa gatgcgtgaa atcgtacctt aggaactcgt ttaacatgag
    4451  tttcgtggac ttatccgatc ccttacttac gattagcgaa tattcggagc
    4501  tggacgttcc tatcaactta ccaggtttcg gtaggatagt ggatggtgat
    4551  gaaactagac ttatggaaga cggtgttaaa tcggcattgt tgcggaaagc
    4601  agttcgagat gaggcacagt tgaatcttaa gagaggtaac acttccgaaa
    4651  tcgttccgtg tgaagacgat gatgactcga acgatgacga ttcacgtgtt
    4701  tcgcgtgatt cggatggtag ctcgccttcg ggcggtagtt ccggcgggtt
    4751  gcgagctgga gctgcccctt ctttgtttag gagtttactc aggaagctgg
    4801  gtgggggttt atgtttagca aagaaagtgt tggaactgtt actcaagcgg
    4851  gtggttgaat cgttttcacg tctgaaacga aagaccactc gtttaacgtc
    4901  tttcgctaat ttgttgcttg cgaggctttc ttgcgggttt ttcgatgatt
    4951  ccgttttttc tgcggtctgg gaaattgcgg tcaatctgac caggatcatc
    5001  gatggagtag ttaagacgaa attagaatgc tttcgaaatt tgtttcgatt
    5051  gattcctaaa ttatatgtcg gttgtaggga cgtcgtgaag gacgttagta
    5101  acgcttacag gtcggctgtt ttgttttctg ctgaaatttt tggtaagagt
    5151  tactctaaac tttgtcagtt ctgcttggaa acgtttgacg tggggcttat
    5201  tgagatttcc gctcgtaatt tgggattaga aacttgcgtc tcaatggcgc
    5251  aggctatttt cgatgtgttg gtcacttttc ctttggggag cgtcagtttt
    5301  tccgtcgttt gtgctagggt tttcggtgct ctcgctatgg aagtaggatc
    5351  aaacttcttg tttaagaaag ttttcggtaa acccgaaact ctaggtgaag
    5401  atgccttccg taggaccgta agtatggttt tgagcgccaa agcgtttgac
    5451  aagctttccg tagatgcgaa aggtttagtt aggtgctctg gtgttattcc
    5501  tggagtgtta aggataatac tatcttcctt gttttccgag gcggatgctt
    5551  gggtgggtta cagtaaacat gaagtttctt cccttcctat agttaccttc
    5601  tgcgtgaaga aattgtctta ttctttggag cagtgtaagg aagtgtgtat
    5651  cgctttcgtt gtcgattctg ctaagaagat tctgaaatct ttaacttctg
    5701  agttcaacga atccattcaa aattccgact tgactagtgg tgctaagtcc
    5751  ttgtacgggc acgtgagctc gatactttcc acctctagcg gtgtgattag
    5801  taaagccgga aacgctgtcg ctactgttaa agcagtcggg agcgatattg
    5851  gtggtcgtgt gaaacgcttg cgaccccgtt tttctctctc ccgtcacttt
    5901  gacgagcaga ctagtgaata ctactctgct agtgattgtt ccgaactgga
    5951  tgagtcgttg ctcagtgaaa cacctggtct tcgtggaaat gggaggtgta
    6001  gagatttatt tcgtatcgta tctagacgca tggtagcgtg tagtgaatac
    6051  ttgataaatc ttttgaaaca attaacatcg cgtgccagtg aatactccta
    6101  ctcgtatgtg atggatttgc ttgtgaggtt gtgtgttgcg acagacgacg
    6151  tcgttaggcg atgcaggtcc tttacattcg actgtgctga taaagcgtcc
    6201  gattttatcg tcgggtgtct cagttggtac aacttgcgtt ctggtgccta
    6251  ctctgcaact cctgggttgg gcggtggtag cagaagttta acaacggttt
    6301  ttcccaccgg tggttttgtg cgcgttatag gggcacttgg gaacgtctta
    6351  tcagtggtgt ttgatgagga attctttaga actttacttc atcggttgag
    6401  gacagacgtt gtggttttat tggtggagtt cttgaaaaac cttcccgtat
    6451  gtttgttttc agtatacact ttctttgagt gtcggggtag ggtttttcct
    6501  ttgagagagt tcctatgggg cttttgtcgt ctcgtttggg aaatcgtcga
    6551  agggttgtcc atcaatgtct atcaacatct ctctgccgtc gttgtgagag
    6601  cgtatcgatg tgcgttcaat cagcggtttt acgaagagga tgagaggaca
    6651  cttcgagtga tcacggaggc ggaaggaaga attgagtttt tgcgagttgt
    6701  tctcgcggaa atggaaaggt tccgtgccgc gtcaaacgag atgtctttgt
    6751  cgaggtcatc tgatagtcct tcattcccac ctacttacgg agaaattgtg
    6801  gaattgaatg acgattcctc tgacagtgcg ctagtgatag gtgtggacaa
    6851  tggcaccggc cgtgcgatcg tcgacagtga gaccgattct gcgtctggta
    6901  gcgacagtga cgtttctatt ccgttggatc gcgattttga gcaaatcggg
    6951  ggtcttggtg gaaacggtaa cgtcgatgtc tttcggctgg gtttgagatt
    7001  cactctgaag ttgttgcgca acctttttaa cgctagaagt tttaaagtgt
    7051  tgtacgggtt gttacttcag actctctttt atggtggttc ggtaaataaa
    7101  tttgtgtctc gtttggtctt tagtcttggg acttgcttac ctttcgagtt
    7151  attccggttt gcgtgttcgg cgaggcggct gttcaagagt ttggcattat
    7201  ttgtttacca agctaacctt ttcagtgaag ctacggtgga gcatttgttt
    7251  agcttttccc ggttacttta tgattcccgg tacttctcga gtgtattttc
    7301  ggaaatagag agatttgatt tctatttaga tcatttcctt tcactcccga
    7351  tgagatatct tttcccaaat tctagggttc gaggttgtac tagggctccg
    7401  gttcttgtga ctaggaccga agaagtgaca ccagactgta agagatcatt
    7451  aaacgacata ttggactctt tggattctct gaaggtgtca gacctcaaag
    7501  ggaagtcgac attcgttgat gatgaggagt cgggttccgg tagtgaacga
    7551  tcgggtagtt cgatctcgtt cggttccatc aacgaggaag tcttaaacgc
    7601  ggtgaacggt gatggcgttt gcgaaaaagc tccgttgatg aaacacgcta
    7651  ccgcgcttag caagttggaa cccgacccta gtggtcgtaa agatattcct
    7701  gtttccaaga aaacctttac gcgcggtgag tgttcgggcg tgaagtcgaa
    7751  ggtaggcttg tgtgattacc tggtgacctt gaattcctcg tttggtacag
    7801  tacctgacat gtaccctgtt gcacgtgaca taacgtataa gaaactaact
    7851  aacgccatgc gcgaatttta ttactcgcaa aaaataacct tgtacgaact
    7901  tcacggaaag ttgagttctt attgggatga gttgaaggtc gcaggtttcg
    7951  atagaaagtt aacgaaaatg gacttggatg atgatgtcta tgttgttgat
    8001  ttcaatcgga agctgttggt ggggagaaat gggtctcacc cgtttcgtgg
    8051  tacgttaaag tcctattgtt ttatgttctg caatgatggg ttggtccctt
    8101  gcccgggttc tcagaagtat gattatgctt tgatttctaa tcaaacgtct
    8151  tttgtcgccg cgaactcgtt cttacgtgct gtggatggta aggatttgac
    8201  ttttaccaat gagggacaca gccttattgt ttatgaggct cctcctggtg
    8251  gtggtaagac tcattctttg gtgaattgtt acgcggatta ttgcgataaa
    8301  gtatcttgtt tagtagtgac agctaataag aattctcaaa ctgagatatc
    8351  tcagcgtgta tctagtgagt tgatgagtag gaagcgatct gctaagtacg
    8401  ttactggtgc ggcttctaga gtgttcactg tggattctta cttgatgaat
    8451  catttgcgac ttacgactca gttgctgttt gtcgatgagt gctttatggt
    8501  tcacgctgga gcaatcggtg ccgtagttga attcacgtct tgtaaagcgg
    8551  tagttttctt tggtgacagc aagcaaatcc actatattca ccgaaacgat
    8601  ctcggggttt ctttgttgca tgatattgat gcatttattc aaccggagca
    8651  tcatatttac ggcgaagtat cctataggtg tccttgggac atttgtgagt
    8701  ggctttctga gttttacccg cgacacgtag ctactactaa tgtcgggagt
    8751  gttgggaaat cgagcgtgtc gatagaggaa atcaatgggt gtgatgacgt
    8801  accttacgac aaggcagcga aatacattgt gtacactcag gctgaaaaga
    8851  acgatctgca aaaacatctc ggtcgtttaa ccgtgggtcg gaccaaagta
    8901  gtaccaattg taaatactgt tcatgaggtt caaggagaga cttataagag
    8951  ggtacgcctg gtgaggttta aatatcagga ggataccccg ttttcttcga
    9001  agaatcatat tgtggttgct ttgactagac atgttgattc tttggtttac
    9051  tccgtgctta ctagtaggag gtacgacgat actgcgacta acatagatag
    9101  ggcaaaggaa atttttgata aatttcgttc gacgaatcac tcgtacggtt
    9151  cgtcatcgtt agaatggtac cttgaaaaat ttcccaccga atataaaggt
    9201  agtaaagcat cctctgctcc gataagttgc attaacgaat tccttaatga
    9251  ggtggtcgtt ggttcttctg tcgtgcagtt gggtgatgtg tctgaagagc
    9301  tgagttcacg tccctttgaa tcagggtgcg ataatgttac cgtaagagac
    9351  actgcccctc ccgactccgg taacttacac gaaccggctc gcgttcggcg
    9401  tagtaaggtc acaagcaatt cctccaagaa aagcgtcgct acaagaaaac
    9451  cttctgtcgt acgaaagtcg taattacaac tttatcaaga cagaacggtt
    9501  tgttggacca agcgattttg gtagggcgat ggctgctgcg gttatcgaac
    9551  gctgtttcaa aatggaagag atggctaaga taaggtgtga tattatatcc
    9601  cttactgagg ctaacatttt gaaatggctt gataagcgca ctccttgtca
    9651  aataaaggca gtgcaggctg agttgaagct tcccttttcg gtggaggagc
    9701  aaattaccaa ctacaaactg atggttaaac gtgatgctaa ggtaaagctt
    9751  gatgactcaa gcctatctaa acatcccgct gcccagaaca taatgtttca
    9801  caagaagttt attaatgcta tattttcccc atgtttcgat gagttcaaaa
    9851  atagagtgtt gtcctcactt aatgacaata tcgtattctt tactgaaatg
    9901  acgaatgctg ggttagcgga agttgtcaga agaatcattg gtgacgacga
    9951  caaccttttt gttggggaag tggacttcag taagttcgat aaatctcagg
   10001  atttgttcat taaggagtac gaacgtacgt tatattccga gtttgggttt
   10051  gataccgaac ttctcgatgt ttggatggaa ggtgagtatc gcgctagggc
   10101  gactactttg gatggtcaac tgagcttttc agttgatggt caacgtcgtt
   10151  ctggaggttc gaatacttgg attgggaatt ctttggtcac tctaggcatt
   10201  ctctcgttat attacgacgt ttcaaagttt gagttactcc ttgtttccgg
   10251  tgacgattct ttaatttatt caagtgagaa gataagtaac ttttcttcag
   10301  aaatttgctt agaaacaggc tttgagacta agtttatgtc tccgagtgtg
   10351  ccgtattttt gttcaaagtt tgtggttcag accggtaaca aaacctgttt
   10401  tgtacctgac ccttacaaat tattagtaaa gttgggggct ccacaaaaca
   10451  agttaaccga cgacgagtta tttgagttgt ttacttcttt taaggacata
   10501  acacaggact ttggtaatca agtggtttta gagaagttga agttgctagt
   10551  cgaagctaag tacgggttta ctagcggaac tactatgccc gctctgtgtg
   10601  ctatacattg tgtacggtcc aattatttat ccttcgagag gttgtttcct
   10651  ttcattaggg gttggtatgt tgtcgatgct ttaaagctta gacaactaag
   10701  gaagttcgcc aatttaatct gtgaacgcat tgttcacgat aatcgcgtgg
   10751  gttatttttc gtactttgac aatccgttta ctaaacccga cgctagcgat
   10801  ggtcaaatgg acgacttgat gactaattga tcgtttgttc agttctcgct
   10851  gagagccaac gttggtagtt gagtcgagat gtttgctttc gcgagcgaaa
   10901  accaagactt attggaagaa aagatatttc gtcgtagaac gtaccatcgt
   10951  aagtattttg atgacgtggt tagggatttc actattgatg ttggttataa
   11001  cgttgatgat cgtgacccta cggtgttggc tgactatttc tcgttgtatt
   11051  tctttttgct taacaacgat aacgttgggc ctttagcggc ttcaattgta
   11101  gtgagcccgc cggttagcgg gacttataaa attcgagcac acgtcgataa
   11151  gcaaccaaat tgcgagggaa acgtgactta cgctaagact gtcgataaga
   11201  atcgttttgc aattctcata aaagcagtcc cggctccaat gagaggttat
   11251  tattcttttc gggcgtttct taccgataat gtcactagcg aacgcagtga
   11301  attcatatgc agttttattg gtagtagatt cctttgttgt tgtacgcaaa
   11351  cgatatccga aaatttgggt aaggtttgtt cgtcctcttt ctcctttaga
   11401  gcggtctcag aaaccgcgat taacgagttt tctgttgcga ctgatgatgt
   11451  agaagacgtc aagtatgtga gaaaacgagc cgagggtttc tcacattgcg
   11501  ctgacccgta ccctcctagg tgttatcgcg gcgctaattt gggcgattct
   11551  tcaggggttc aaagtcgtac aatcgaagaa gaaggttata ggacggatac
   11601  cgcaggtgac gtcgcggtca ctatcccgaa caccccactt gttagtgctg
   11651  tctctccgta tgtcgcagag tacaacgaaa atacgcgttc gcgtatttcg
   11701  ttagtacgcc gagtctgttg ttacgccgtt tgtgttttag tggtgtctct
   11751  tcttataatg agcggtttgt taaccattat attcatatga tttgatgtag
   11801  taacttacga ggtacaatta gctaaaactc gccgtttgac tctgtttaaa
   11851  cgggtttcaa tggactgtgt gattcaagga tttctgactt ttctggttgg
   11901  tatagctgtg tgttcggcct ttgccggact gattatcatt gttataacga
   11951  tttatcggtg tacaactaag cctgttagaa acacctctcc ttacggtact
   12001  cacgccactg tctaagcaat atggtactct tgggtttaga ctttggtacc
   12051  acgttttcga cggtggctat ggctacgtct tctgagttag ttatactcaa
   12101  acaatctaat tcatcgtata tacctacgtg tttgtttctg cacgcagatc
   12151  ctaacagcgt gtcttatggt tacgatgcgg agtatttagc ggcttcaggg
   12201  gaacccggct cgttttacaa agatttgaaa cggtgggtcg gttgtactga
   12251  gaagaattac caaagctact tgcacaagtt gtcaccatct tataaggtga
   12301  tagtgaaaga gtttggagct aagagtatgc cggttccata tttatcacct
   12351  ttgaataatg atcttgggct cagcgtcgct ttgccttcat tgatcgcttt
   12401  atacaccaag tccattttat cggatgcgga aagagtgttt aacgtgagtt
   12451  gtactggtgt tatatgttcg gtacctgctg gttataatac gttacagcga
   12501  gcttttacgc aacaaagtgt atccttgtcg ggttactctt gcgtgtatat
   12551  tattaatgaa ccttctgctg ccgcttactc cactctacct aagttgagtt
   12601  cggcagataa gtatttggcc gtttacgatt tcggcggtgg aacctttgat
   12651  gtttctatag ttagcgttag attacctaca ttcgctgtta gaagttcagg
   12701  tggtgatatg aacttaggcg gtagagacat tgatagaaaa ttgtctgata
   12751  aaatatatga gttggctgaa tttctaccgc aaaaagagtt gaatgtgtcc
   12801  agtctaaagg aagccttatc tcttcaaacg gatccagtca agtataccgt
   12851  aactaattat gggattagtg aaacagtatc aatcgaccaa acgactttga
   12901  gggagatagc ttcggtgttt ataactcgaa cgatagacat acttacacaa
   12951  gttaaggtta agtctagtat gcccgagtcg caaagtttga agctagtagt
   13001  agtcggtgga agctcgtacc taccagggtt gttggatact ttggaaactg
   13051  taccttttgt gtctgggata ataccagtgg aagacgctag gaccgccgtt
   13101  gctagagggt gcgccttata ttgcgaatgc ttggatggta ggtccaaggc
   13151  cttattaata gattgcatca cgcatcattt atcggtcacg acatttagtg
   13201  cagactcggt tgttgttgct gcggccggaa gtccaattcc tttcgaagga
   13251  gaacgaaaac tcacgttacg taagtgcgtt agtacgtcta attatcaagc
   13301  aaggatgttc gaaggagatt acgaaaaggt tttccgaaac gagcgtatat
   13351  acgcagcttc ggtatcattg tttactttgg gagttaactg gcgcgtgccc
   13401  aacgacgttg agatgactct tgtgaccaga gtggattcaa tgggtgaagt
   13451  ggaattctac cttaaaggtc catctggtga attagttaac gtgcaaggta
   13501  cttcacatta tgattatgtt ggtatgcctc atcctactag gaagttgttg
   13551  aggcttagcg attacaatgt aaactccgca gctttagttt tagctttgac
   13601  gttgactcgc gaaaaacgag aaaaatttct tttgcgaacg ttatttgatg
   13651  ttttactagc agacttacga aagaccgcaa gcttgagcga atattctaag
   13701  aaatacccga tcactcgaaa cgacatcgat gtcgtctcat cacgtatggg
   13751  gatcgttgtt tcgaaagttt tacggggaag cgatttggaa agaatacctc
   13801  tctgaatcaa ctcgaaattt cgatgagaga aacgtgtcgt tggaccacac
   13851  tctgagttcg ggtgtggtcg tccgtaggca gagtcttttg aacgcgcctc
   13901  aagggacttt cgagaacgag ttagcactat tgtacaattc ggtggtgatt
   13951  aatgacttcg ttgagttcac tggtatgccg ttgaagtcct tgatgatagg
   14001  tatcgaggac cgtaaggtac cagacgagtt aatatccgtt gacccgcatg
   14051  aagttggatg taaatttacg ttaaatgacg tggaatcata tctaatgagc
   14101  aggggtgaag attccgctga tgtgacggcg gtcgagcact cgtggtgttt
   14151  gagtaattct tgcggtagat tattaagttc gactgagata gatgcttaca
   14201  aaaccatagt gtttactgag aatttcgata gtagtgtatc tggggtgact
   14251  actaagttag agacttattt atcgtactgc atatcgttgt acaagaaaca
   14301  ttgcatgaaa gacgatgatt atttcaatct tatcttacct atgtttaatt
   14351  gtttaatgaa agtgctggca tcgcttggtt tgttttatga gaaacatact
   14401  gacaatccgc tactgaccgg tatgctcata gagttttgcc tagaaaataa
   14451  ggtgtattac tctactttta aagtaaattt agacaacgtt agatcgttta
   14501  agtctaaagt gttgcctgtg gtgttaacgg tctgggatat atctgagcct
   14551  gatgacccgg tggatgaaag ggtgctaatt cctttcgatc ctacggattt
   14601  cgtgctcgat ttacctaaat tgaatataca cgacacaatg gtggtggtgg
   14651  gtaatcaaat cagacagtta gagtgcgtag tcgagggcga tgctttagac
   14701  gatttatctc aacacgttga catacgttta gcagcggaca accccgatct
   14751  acgcgttgat ctgcgttggg cggggatgtt tgtctactac ggtgtttatc
   14801  ggtgtgctat tgatagagcg gtagaacgac cgacgttatt tagattgccg
   14851  cagaagttac tgagtcagga tgatggcgaa tcgtgctcat tacgcatgag
   14901  tgccgtcgaa gctttgttta atctggtgca aaaggtgaac agggacataa
   14951  acgttagacg tcagttcatg ggacgtcaca gtaaagtggc tttgcgactg
   15001  tatcgcaact taggtttgag gtttccaccg atctcttcag ttaggttacc
   15051  ggttcatcac agttatttat acgtcgattt ttacaaaaga gtacctgacg
   15101  atgctgttac tgccgacgaa ctcgaaagtt tgcgtcaatt acgttcgtcc
   15151  gtggacgtta tgtgtaagga cagggtgtca atcacacctc caccattcaa
   15201  tcgacttaga agaggttctt ctagaacatt tagaggtcga ggcgcacgcg
   15251  gtgcgagctc gcgtcatatg agcagagacg tggcgacttc cggttttaat
   15301  ttaccttatc atggcaggtc atacaatact tcctaagatc gatgacaaag
   15351  aaatggatcc ggtgagtgcc gctgtgcccg gtaagtatcc ggatgtcgtt
   15401  gagaaatttg tggccaatag gtccgtagat gcgttaatag aaggcgttat
   15451  aagtaagttg gataccaatt caatatacga ggattccact gaaaaattta
   15501  ctggtgaata cttgaaatac gtcatggtta ctatggatac tttcttatta
   15551  gaaaactaca agacgaaaac ggaagatctg ttggttcgct tagctatgat
   15601  ccaaaagagg ttgtgcacta tatccacgag cactaaaacc aagttccgtg
   15651  ataaaggttg tattagttac gtgcaagggg gttcgcggta taagttaatg
   15701  gataaagtag tttttccttt cattatatcg aaatttaccg atagggagac
   15751  cccgaacgct ctacgtaagt atgcttgcac tttcgaggag ttacacttat
   15801  gtatggctag gttgagaccg gacttatacg aaaataaaag gacgaccaaa
   15851  gccgggactc cgcatttaaa gggctactta tcagccgact ttctttcggg
   15901  ttctctccca gggtactccg aacatgagcg aggtatcatt cttcgagcgt
   15951  ctgagtctat gttagctaga cgtcaaggtt acgaggaggc aaccgagctt
   16001  cttaatctac gcgatttggg taagtacttg tagttggttt ggggacggta
   16051  atattatacc atcctttgag cgctgcttta agggtcgtta attgacgact
   16101  cttgatatat ttactaggtt cgaattatgg acgacgaaac aaagaaattg
   16151  aagaacaaag acaaggaaac gaaagaaggc gacgatgttg ttgccgctga
   16201  gtcttctttc ggttccttaa acttacacat cgatccaact ctgatagcga
   16251  tgaatgacgt gcgtcagttg ggtacccaac agaacgctgc tttaaacaga
   16301  gacttatttc ttactttgaa agggaagcat cctaacttac ctgacaaaga
   16351  taaggacttt cacttagcta tgatgttgta tcgtttagca gttaagagtt
   16401  catcattaca aagcgatgac gatactacgg gtataacgta cactcgggag
   16451  ggtgttgaag tggatttgcc tgacaaactt tggactgacg tcgtgtttaa
   16501  ctccaagggt attggcaacc gtactaacgc ccttcgagtt tggggtagaa
   16551  ctaacgatgc cctttactta gctttttgta gacaaaatcg caatttgagt
   16601  tatggcggac gtccgctaga tgcagggatt ccggccgggt atcattacct
   16651  gtgtgcagat ttcttgaccg gagctggctt gactgattta gaatgtgctg
   16701  tgtacataca agctaaagaa caattgttga agaagcgagg agctgatgaa
   16751  gttgtagtta ccaatgtcag gcagcttggg aaatttagca cacgttgatc
   16801  tgttgcgttc cgactcccgg tttttaccgg gatggtggag tttcatcgtg
   16851  aacgtgggtg atataatagt ccggtttgcg ttacacgttc ctaatgaaga
   16901  tatgctgaat agtttttcag ctatatcgaa ttgtacgatc atagcggacg
   16951  gtagtgcttt attaaaagac aataccgtgg ttgatcgttt agaaggtatg
   17001  aatcctttgg cttacttgtt aaatttagcg aaaacgacta ctactatttg
   17051  ttttactatg tctaataagg ttctttttgg tactactaaa tctgaaccac
   17101  ttagttgttt agctatcacg tcagatcgag ttttgttcaa agttattatg
   17151  ggcactaacg ttgatgattc tcgatgtggc tgcagtattt ggttttacga
   17201  caatggtacg tttcaaaacg gattgatccg ttgtaataat ctcgtcgctt
   17251  tgtttagcgc gacttagaca cgaagtgacc gttcggattt aattgctgca
   17301  atgagctttc gacgcttgtg gttaaaggtt atagctgtag ttacggtatt
   17351  atggtacggt aaagaacctt ccattagtga aggttacaat gctcttatga
   17401  atgatgattt taagtttatc gatacgcatt tttcaaacgt ttcttatgct
   17451  aagaaatgtt acgatttggc taatttcgat ttagactttc tacgcatcgt
   17501  tatcattcct ttgagtggtg gtacggtgaa cgaatcgcgt gctaatcacg
   17551  ctaacgtctc agagattgtc gaatcgcata taagcgaccg agacagaatg
   17601  agcatcttgt tgcgtaataa gcgtatccaa attccttcgc tcttaccttg
   17651  cggtgactag agtctactca gtagtacgtc tactagtata acgtattaaa
   17701  cactttagta aagagttttg tttaagttga acaatatgcg agcttacttt
   17751  agtgttaacg attacataag ccttttagct aaggttggcg cagttgtgga
   17801  acgtttatgc gatcccagcg taactctcac ggaagtgatg gacgaaatta
   17851  atgactttaa ctcgttcctc gctttggtgc actctatgaa gtcggacatg
   17901  aacggagatc atcaggatgg tcaccatgag atgggtgaac acaagtctcg
   17951  gttattgtgc aacatagagg cgaaactgcg agtacttctc gacatcataa
   18001  gacgtcggtt cactcgcgaa aaactgctct gtaccagtgc tacggatgtc
   18051  atgggcttct tcgtcgtgag gtacatgagt tctagtcaca ccagttttga
   18101  gtccgtaatg cacacggaat tgaagttagt ggttaaggcg gtgctgtcag
   18151  atttgtcccg cacgcataaa ctagatttta gcgagcgagc ctttgcggct
   18201  tacggtatcc ttttacaaaa gggtgccgtg gcaaccgttt gtagtcagtt
   18251  tgacattaat ttagtttctc cgtcttgcgt gtaggttaat acgcttctca
   18301  gaacgtgtgg ttgtattaac taactttaat tcgaacaaat ttattgttta
   18351  aagtctgtga gttacgatga acgatactag cggacaaact ttcgtttctg
   18401  tgaacctttc tgacgaaagc aacacggcga gcactagagt tgaaaacgta
   18451  aaaccggaag cggatcgctt ggagttttta cgtaaaatga atcccttaac
   18501  tattgacgct ctggtgcgga aaaccaatta tcagggcgct cgctttcgtg
   18551  cgagaataat aggagtatgc gtggattgtg gtagaaaaca cgacagggcg
   18601  ctcaagactg aacgtaagtg taaggtcaac aatacgcagt ctcagaacgg
   18651  ggtggcgcat atgttgatgc acgatcccgt taaatattta aacaaaagaa
   18701  aggctagagc cttttctaac gcagagatgt ttgcgattga attggttttg
   18751  tacaccaagg aaaagcaatt ggcggttggt ttggccgccg aaagggagaa
   18801  gacgaggttg gctcgtagac acccaatgcg ttctccagag gaaactccgg
   18851  aacattataa attcggtatg accgctaaag cgatgttacc ggaactcaac
   18901  gctgtaggcg ttggtgataa cggagacact tcgtcggaat acccagtaag
   18951  tctgagtgtt tccggtggag ttctccgtga acaccacttc atctgattga
   19001  agtggacgga ataagttcct tgcggaactt tatatcgggt tggtaaaaac
   19051  ccttatgatg gtgatatatc actagacaat aaccggatgg gtaaagtctt
   19101  taaaatgatc gaggggaaag attaaccgta tcctctcgtt ggtctaagct
   19151  cccacagagt ggtagtggtc tcaagtgagg cttaacgtat gtgtgaacca
   19201  aagaagttct ccttagagtg tgtgttgttt acccaacaca ctgtccctat
   19251  ggggggccaa cataggtcca