Sequence of DPV Citrus tristeza virus

Citrus tristeza virus clone Z14 coat protein gene, complete cds.

ACC No: FJ622884

Dated: 2009-03-08 | Length: 672 | CRC: -1836475472

                
ID   FJ622884; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ622884;
XX
DT   08-MAR-2009 (Rel. 100, Created)
DT   08-MAR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Citrus tristeza virus clone Z14 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Liu Y., Zhou C., Atta S., Zou Q., Cao M.;
RT   "Preliminary characterization of CTV isolates from Zhejiang, China";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Liu Y., Zhou C., Atta S., Cao M., Zou Q.;
RT   ;
RL   Submitted (12-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   National Citrus Virus Exclusion Center, Citrus Research Institute of
RL   Chinese Academy of Agriculture, 15 Citrus Village, Beibei, Chongqing
RL   400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="grapefruit"
FT                   /mol_type="genomic RNA"
FT                   /country="China:Zhejiang"
FT                   /collection_date="12-Oct-2008"
FT                   /clone="Z14"
FT                   /note="PCR_primers=fwd_name: CTV-CP1, rev_name: CTV-CP3"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACN43309.1"
FT                   /translation="MDDETKKLKNIDKETKEGDNVVAAESSFGSLNLHIDPTLISMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVNLSDKLWTDVVFNSKGIGNRTNALQVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 195 A; 123 C; 166 G; 188 T; 0 other;

fj622884 Length: 672  08-MAR-2009  Type: N  Check: 4068  ..

       1  atggacgacg aaacaaagaa attgaagaat atagataagg aaacgaaaga
      51  aggcgacaat gttgttgctg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactttgata tcaatgaatg atgtgcgtca gttgggtacc
     151  caacagaacg ctgctttgaa tcgagactta tttcttactt tgaaagggaa
     201  gtatcctaac ctacctgaca aagacaagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggtcaag agttcatcat tacaaagcga tgacgatacc
     301  acgggtataa cgtacactcg ggagggtgtt gaagtgaatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttca agtttggggt agaacaaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagacgcagg
     501  gattccggct gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga