Sequence of DPV Tobacco necrosis virus D

Tobacco necrosis virus D isolate TNV-DP, complete genome.

ACC No: FJ666328

Dated: 2009-07-14 | Length: 3761 | CRC: 1752977237

                
ID   FJ666328; SV 1; linear; genomic RNA; STD; VRL; 3761 BP.
XX
AC   FJ666328;
XX
DT   14-JUL-2009 (Rel. 101, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Tobacco necrosis virus D isolate TNV-DP, complete genome.
XX
KW   .
XX
OS   Tobacco necrosis virus D
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3761
RX   PUBMED; 19506797.
RA   Cardoso J.M., Felix M.R., Clara M.I., Oliveira S.;
RT   "Complete genome sequence of a Tobacco necrosis virus D isolate from olive
RT   trees";
RL   Arch. Virol. 154(7):1169-1172(2009).
XX
RN   [2]
RP   1-3761
RA   Cardoso J.M.S., Felix M.R., Clara M.I., Oliveira S.;
RT   ;
RL   Submitted (28-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Biology, University of Evora, Evora 7002-554, Potugal
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3761
FT                   /organism="Tobacco necrosis virus D"
FT                   /host="Olea europaea L."
FT                   /isolate="TNV-DP"
FT                   /mol_type="genomic RNA"
FT                   /country="Portugal"
FT                   /collection_date="1998"
FT                   /db_xref="taxon:12056"
FT   CDS             39. .2216
FT                   /codon_start=1
FT                   /transl_except=(pos:645. .647,aa:OTHER)
FT                   /product="p82"
FT                   /note="RNA-dependent RNA polymerase; RdRp; read-through
FT                   stop codon"
FT                   /protein_id="ACT31460.1"
FT                   /translation="MESLPIVLLSLISKTVELICSLLTLIIQNSTAVTWGLVCVWLAYV
FT                   SLRFLFQVKITVHPAARETFESMVRKFQAESMFSEEAIPCVVSVGDKDADLTLDPQRED
FT                   IKIVKSSRRVSYAVRVAHVAKAQVGLLTNSRANELVYSRLCREEMVKHGVRPSHIAHMV
FT                   PLAVAACFIPLDSDFLAASIRQGEGMRERRALLGPSWEKXGGLLVTSGFTTPTWRGDPR
FT                   GMLVTKGPPLAKPRKLYRFTGMGTHIRYGVHDHSLGNVRRGLVERLYMVEVKGELQPTP
FT                   KPIPGAFNQMSRFSDRLSIHLPKTTRLTPKEFLGFYTGRKLERYQKAVESLEMHPVREK
FT                   DAWLSTFVKAEKLNITAKPDPAPRVIQPRDPRYNVEVGRFLRHSEEMLFKAINKTFGGR
FT                   TIFKGLSSDQAGEEFKALWDSFKDPVGIGMDASRFDQHISKDALEFEHKMWLSMFPKSE
FT                   RAELARLLSWQINNRGLARCPDGEIRYRVEGCRMSGDMNTSSGNCYIMCATVHNWCDNI
FT                   KHIKHFRLANNGDDCMLVVERSDEEKVRNGLIEYYATLGFTMKVEPTVDVLERLEFCQT
FT                   RPVLVDGKYRMVRNLHQSMSKDLHSLHDLDSIAARNAWVTAVGTGGRCMNDGVPVLKEF
FT                   FKQFPDYNLEAKKGSDMAQKLRDDWKYKFNRTAAFQDLKPTQESRYSFWLAFGLLPDEQ
FT                   IALEDGFSPLKMEIVNEQIQEEVSLLQFSGA"
FT   CDS             39. .647
FT                   /codon_start=1
FT                   /product="p22"
FT                   /protein_id="ACT31459.1"
FT                   /translation="MESLPIVLLSLISKTVELICSLLTLIIQNSTAVTWGLVCVWLAYV
FT                   SLRFLFQVKITVHPAARETFESMVRKFQAESMFSEEAIPCVVSVGDKDADLTLDPQRED
FT                   IKIVKSSRRVSYAVRVAHVAKAQVGLLTNSRANELVYSRLCREEMVKHGVRPSHIAHMV
FT                   PLAVAACFIPLDSDFLAASIRQGEGMRERRALLGPSWEK"
FT   CDS             2213. .2401
FT                   /codon_start=1
FT                   /product="p71"
FT                   /protein_id="ACT31461.1"
FT                   /translation="MKTHQFHLKIESRWKTQKMSVVGGTNESIVRKGSRRVAIRKLAKL
FT                   PCAGKVMLSRTWVLQFQ"
FT   CDS             2251. .2448
FT                   /codon_start=1
FT                   /product="p7a"
FT                   /protein_id="ACT31462.1"
FT                   /translation="MENTENVRSGRNQREYSKERQQEGGYKEVSKAAVRREGDVKQDMG
FT                   PSVSMTVVGEKVEFTQHFHF"
FT   CDS             2448. .2648
FT                   /codon_start=1
FT                   /product="p7b"
FT                   /protein_id="ACT31463.1"
FT                   /translation="MAYIIVHQRDPFPLLGAWIIVIIIVAVIGLLNQSSPERPYQTFKE
FT                   DNSKIQYITIGGSTTTKVSTS"
FT   CDS             2650. .3456
FT                   /codon_start=1
FT                   /product="p29"
FT                   /note="coat protein; CP"
FT                   /protein_id="ACT31464.1"
FT                   /translation="MPKRGRVGLAESFQSKTKKQKENEYNAFQREKMERALANNARAAS
FT                   KGSGMTFRPLTVPVAGSVIYSRPRVPQVRTNQMSTLVVNTELVANITLAAAGAFSFTTQ
FT                   PLIPSFGSWLANIASLYSKWRWISCSVVYIPKCPTSTQGSVVMAIVYDAQDTVPTTRTQ
FT                   VSQCYQSITFPPYAGYGGASALNHKGSGGESLVSTLDTNRVDKRWYSTIGNAAFTALTS
FT                   LDKNQFCPATAIIAGDGGPAAATAVGDIFMRYEIEFIEPVNPTIKI"
XX
SQ   Sequence 3761 BP; 1029 A; 791 C; 955 G; 986 T; 0 other;

fj666328 Length: 3761  14-JUL-2009  Type: N  Check: 8608  ..

       1  gatacctaac cagtatctca gtgattaagt aatcagctat ggagtcctta
      51  ccaattgtcc ttttatccct tatttccaag acagttgagc tcatctgtag
     101  tttgttaacc ctaataatcc aaaattccac agcagtgaca tggggcctag
     151  tgtgcgtatg gctggcatac gtttcgctca ggttcttatt ccaagttaaa
     201  atcacagtcc accccgcagc ccgcgagaca tttgaaagca tggtgcgtaa
     251  gttccaagct gagtctatgt ttagtgagga agccatacct tgcgtagtta
     301  gcgtaggtga caaggacgca gatctcaccc tcgatccaca aagagaggat
     351  ataaaaattg tgaagtcttc gagaagagtg agttatgcag tccgtgttgc
     401  ccatgttgcc aaagctcagg tagggttact caccaacagc agagccaatg
     451  aattggtcta cagccggttg tgcagggaag agatggttaa acatggagtg
     501  agacccagcc atatagcaca catggtgcca cttgctgtag ctgcatgctt
     551  catccctctg gatagtgact ttttagccgc ttctattaga cagggtgaag
     601  gcatgaggga gcggagggcc cttttagggc cctcatggga gaaataggga
     651  ggcctattgg tcacaagcgg attcactaca cctacatggc gtggtgatcc
     701  gaggggtatg cttgtgacca aaggacctcc cctcgcgaaa ccccgtaaat
     751  tgtaccgatt tactgggatg ggaacacata ttcggtacgg agtgcacgac
     801  cactcattgg gcaatgttcg gcggggacta gtggaaagat tatatatggt
     851  tgaagttaaa ggagaacttc aacctactcc aaagcccatc cccggagcgt
     901  tcaaccagat gtcccggttc agtgaccgac tgagtatcca tctacctaag
     951  accacccgct tgacacccaa ggaatttctt gggttttata cgggtcgcaa
    1001  gttggaaaga taccagaagg cagttgagtc gttagagatg catcccgtga
    1051  gggagaagga tgcctggctt agtacgttcg tgaaggctga aaaattgaat
    1101  atcacagcca aacccgaccc cgctccacgg gtgatacaac ctagagatcc
    1151  taggtataat gtggaggtgg ggcgcttttt gcgacacagt gaggaaatgt
    1201  tgttcaaggc cattaataag acatttggcg gaaggactat tttcaagggc
    1251  ctcagttctg atcaagctgg ggaggagttt aaagcactct gggattcttt
    1301  caaggatcca gtcggcattg gtatggatgc ttctagattt gaccagcaca
    1351  tatctaaaga tgctcttgag tttgagcaca agatgtggct cagcatgttc
    1401  cctaaaagtg agcgtgctga gttggctcga ttgttgagtt ggcagatcaa
    1451  taatagaggc ctagcccggt gtccggatgg ggagattaga tacagagtgg
    1501  aagggtgtag aatgtctggg gacatgaata cctctagcgg gaattgttac
    1551  attatgtgtg caacagtgca taactggtgt gacaatatta aacatatcaa
    1601  gcatttcaga cttgccaata atggtgatga ttgtatgctg gttgttgaac
    1651  gcagtgatga ggagaaagtc cgcaatgggc taattgagta ctatgcaaca
    1701  cttggattca caatgaaggt tgagcctaca gtggatgtat tggaaaggtt
    1751  agaattttgc cagacaagac ctgttttagt ggatggcaag taccggatgg
    1801  tgcgaaacct tcatcagagc atgtctaaag atctacactc attgcatgac
    1851  cttgatagta ttgcagcgcg taacgcatgg gttacagccg ttggaactgg
    1901  aggaaggtgt atgaatgatg gggtgcctgt tcttaaagaa tttttcaaac
    1951  agtttccaga ttataatttg gaggccaaga aaggttctga tatggcacaa
    2001  aaattgagag atgattggaa gtacaagttc aataggactg ctgcttttca
    2051  ggatctcaaa cctactcagg aatcacgtta ctccttttgg ttggcgttcg
    2101  ggttgctacc tgatgaacaa atcgccctgg aagatggctt ctccccttta
    2151  aagatggaga tagttaatga gcagatccag gaggaggtgt ccctcctcca
    2201  gttttctggg gcatgaaaac tcaccaattt caccttaaga tcgagtctag
    2251  atggaaaaca cagaaaatgt ccgtagtggg aggaaccaac gagagtatag
    2301  taaggaaagg cagcaggagg gtggctataa ggaagttagc aaagctgccg
    2351  tgcgcaggga aggtgatgtt aagcaggaca tgggtccttc agtttcaatg
    2401  acggtggtgg gtgaaaaagt tgaattcacc caacattttc atttttaatg
    2451  gcctacatca ttgttcatca acgtgaccca ttcccccttt taggggcttg
    2501  gatcatcgtt atcatcattg tcgcagttat tggtttatta aaccaaagct
    2551  ctcctgaaag accttaccaa actttcaaag aagataattc taagattcaa
    2601  tacattacaa tcggaggatc aaccactaca aaagtgtcta ctagttaata
    2651  tgcctaagcg aggaagagtt ggattggctg aatcttttca gtccaagaca
    2701  aagaagcaga aggagaatga atacaacgcg tttcaaagag agaagatgga
    2751  acgagctctg gcgaacaatg cccgcgcagc atcaaagggt tctgggatga
    2801  cttttcgtcc cttgactgtt ccggttgctg ggtctgttat ttatagcagg
    2851  ccacgcgtgc cgcaggttcg caccaaccag atgtccaccc ttgtggtcaa
    2901  tactgagttg gttgccaaca ttactttggc agctgcagga gcgtttagtt
    2951  tcacaacaca accgttgatt cctagttttg ggtcctggtt agcaaacatc
    3001  gcgagtctct attccaaatg gagatggata tcgtgttctg tcgtgtacat
    3051  accaaaatgc cccacttcta ctcaagggag tgtggttatg gcgatagtat
    3101  acgatgcaca agatactgtt ccaactacgc ggacacaagt ttcacaatgc
    3151  taccaatcca ttacattccc tccatatgct ggatatggag gagcctctgc
    3201  actgaaccat aagggttctg gtggtgaatc attggtgtcc actttggaca
    3251  ccaatagagt ggataaacga tggtacagca ccatcggtaa cgctgctttt
    3301  actgctctta catcacttga caagaaccag ttctgtcctg ccacagctat
    3351  aattgctgga gatggaggac ctgctgctgc cactgctgtc ggagacatct
    3401  ttatgcgcta cgagatcgag ttcattgaac cggtcaatcc caccatcaaa
    3451  atttaattgc tttcatagac ccgtcttccg ggagacgtta agaagatgcc
    3501  cgtggaaaat agtaggtaga gttgtggcgt gacaacccac aactgcatct
    3551  ctttgcttat ctagttacaa tatatgttga cgtacaagaa ggatcctggg
    3601  aaacaggttc aacgggctca ctgtggtggt gagccgtcgc atcacttgta
    3651  tgtgctccaa tattggttgt cgataagcgt cctgacatgg ctccatgcaa
    3701  cagcatgggg gggtccagag tcagtcccct ctttatttac ctagagattc
    3751  ctctaggaat t