Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate S16 coat protein gene, complete cds.

ACC No: FJ667601

Dated: 2009-02-24 | Length: 672 | CRC: 1300750777

                
ID   FJ667601; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ667601;
XX
DT   24-FEB-2009 (Rel. 99, Created)
DT   24-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate S16 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Liu Y., Zhou C., Cao M., Zou Q., Atta S.;
RT   "Preliminary characterization of CTV isolate collected from Chongqing,
RT   China";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Liu Y., Zhou C., Cao M., Zou Q., Atta S.;
RT   ;
RL   Submitted (17-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   National Citrus Virus Exclusion Center, Citrus Research Institute of
RL   Chinese Academy of Agriculture, No.15 Citrus Village, Beibei, Chongqing
RL   400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="S16"
FT                   /mol_type="genomic RNA"
FT                   /note="PCR_primers=fwd_name: CTV-CP1, rev_name: CTV-CP3"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACN22836.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSINLHIDPTLISMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWIDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 200 A; 132 C; 164 G; 176 T; 0 other;

fj667601 Length: 672  24-FEB-2009  Type: N  Check: 7210  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgatcc aactctgata tcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tacaaagcga tgacgacact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatc tgcctgacaa
     351  actttggatt gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt aggactaacg atgcccttta cttagctttt
     451  tgtagacaga atcgcaactt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggca gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaacta
     601  ttaaagaagc gaggagccga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga