Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate D10 coat protein gene, complete cds.

ACC No: FJ667602

Dated: 2009-02-24 | Length: 672 | CRC: -838637328

                
ID   FJ667602; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ667602;
XX
DT   24-FEB-2009 (Rel. 99, Created)
DT   24-FEB-2009 (Rel. 99, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate D10 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Liu Y., Zhou C., Cao M., Zou Q., Atta S.;
RT   "Preliminary characterization of CTV isolate collected from Chongqing,
RT   China";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Liu Y., Zhou C., Cao M., Zou Q., Atta S.;
RT   ;
RL   Submitted (17-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   National Citrus Virus Exclusion Center, Citrus Research Institute of
RL   Chinese Academy of Agriculture, No.15 Citrus Village, Beibei, Chongqing
RL   400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="D10"
FT                   /mol_type="genomic RNA"
FT                   /note="PCR_primers=fwd_name: CTV-CP1, rev_name: CTV-CP3"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACN22837.1"
FT                   /translation="MDDETKKLKNENKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTREGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYLQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 196 A; 124 C; 172 G; 180 T; 0 other;

fj667602 Length: 672  24-FEB-2009  Type: N  Check: 3336  ..

       1  atggacgacg aaacaaagaa attgaagaac gaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag ctgagtcttc tttcggttcg ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgcca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcccaac ttacctgata aagataaaga ctttcacata gctatgatgt
     251  tatatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggaaggtgtt gaagtggagt tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccagcc gggtatcact acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gcggtgtact tacaagctaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggtcgta gttactaatg tcaggcagct
     651  tgggaaattc aacacacgtt ga