Sequence of DPV Beet yellows virus

Beet yellows virus coat protein gene, partial cds; p20 gene, complete cds; and p21 gene, partial cds.

ACC No: FJ711759

Dated: 2010-01-21 | Length: 1615 | CRC: 1522058136

                
ID   FJ711759; SV 1; linear; genomic RNA; STD; VRL; 1615 BP.
XX
AC   FJ711759;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   21-JAN-2010 (Rel. 103, Last updated, Version 1)
XX
DE   Beet yellows virus coat protein gene, partial cds; p20 gene, complete cds;
DE   and p21 gene, partial cds.
XX
KW   .
XX
OS   Beet yellows virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-1615
RA   Tabejamaat Z., Massah A., Ahoonmanesh A.;
RT   "Characterization of ORF6, ORF7 and ORF8 of Beet yellows virus";
RL   Unpublished.
XX
RN   [2]
RP   1-1615
RA   Tabejamaat Z., Massah A., Ahoonmanesh A.;
RT   ;
RL   Submitted (28-JAN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Isfahan University of Technology, College of Agriculture, Plant Protection
RL   Department, Isfahan 84156, Iran
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1615
FT                   /organism="Beet yellows virus"
FT                   /host="sugar beet"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran"
FT                   /collection_date="Oct-2006"
FT                   /note="PCR_primers=fwd_name: BYV A, rev_name: BYV Z"
FT                   /db_xref="taxon:12161"
FT   CDS             <1. .591
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="ORF6"
FT                   /protein_id="ACV89926.1"
FT                   /translation="AIATFENVSLADQTCLHGEDCDRLRKNFEECLKLKGVPEDNLGIA
FT                   LGLCLYSCATIGTSNKVNVQPTSTFVKASFGGGKELYLTHGDLNSFLGSQKLLEGKPNK
FT                   LRCFCRTFQKDYISFAKEYRGKLPPIARANRHGLPAEDHYLAADFISTSTELTDLQQSR
FT                   LLLARENATHTEFSSESPVTSLKQLGRGLGTGR"
FT   CDS             588. .1130
FT                   /codon_start=1
FT                   /product="p20"
FT                   /note="ORF7"
FT                   /protein_id="ACV89927.1"
FT                   /translation="MTSSVELAQTKPLFRVLLLKGFVFYVVAFETEEESSEAELPLVYL
FT                   HDFELNINKRGKIEASYVDFMSCMTRLKPSSVSYTRVSSEKSSEDFSLPGSGKTFGSKI
FT                   LNRKVTFTFENGIQLVFGMYGLEQRCVSSDYLWFENVFVGAHCGTLTYCLNCELDKSGG
FT                   ELEILTFSKNEVLLKRW"
FT   CDS             1105. .>1615
FT                   /codon_start=1
FT                   /product="p21"
FT                   /note="ORF8"
FT                   /protein_id="ACV89928.1"
FT                   /translation="MKFFLKDGETSRALSRSESLLRRVKELGTNSQQSEISECVDEFNE
FT                   LASFNHLLVTVEHREWMEQHPNQSSKLRVPSRIGEMLKEIRAFLKVRVVTPMHKETASD
FT                   TLNAFLEEYCRITGLAREDALREKMRKVKSVVLFHHSELLKFEVTENMFSYTELLKLNL
FT                   SLRVISS"
XX
SQ   Sequence 1615 BP; 458 A; 342 C; 371 G; 444 T; 0 other;

fj711759 Length: 1615  21-JAN-2010  Type: N  Check: 8677  ..

       1  gcaatcgcga cttttgaaaa cgtaagtctc gcagaccaaa cctgtttgca
      51  cggagaagac tgcgatagac ttaggaagaa cttcgaagag tgtttgaaat
     101  taaaaggggt tccggaagat aacctcggaa tcgcgttagg actttgtttg
     151  tattcctgtg ctacgatagg cacttccaac aaagttaacg tccaaccgac
     201  gtctaccttc gtcaaagctt cgtttggtgg tgggaaggaa ctgtacctca
     251  ctcacggtga tctgaattcc tttctggggt ctcaaaaact tttggaggga
     301  aaacctaaca aattgcggtg tttctgccgt acttttcaga aggactacat
     351  atccttcgcg aaggaatacc gagggaaatt acctccgatt gccagagcta
     401  accgtcacgg tctacctgct gaagatcact acttagccgc tgacttcata
     451  tcgacgtcga cggaactcac tgacctacaa caaagtcgtc tgctgttagc
     501  gcgcgaaaac gccactcaca cggaattctc gtctgaatca ccggtaacca
     551  gtttgaaaca actaggtcgt ggtctgggca ccgggagatg actagttctg
     601  tcgaactagc tcagacaaaa ccccttttta gagtattgct attaaagggc
     651  tttgtttttt atgttgttgc gttcgaaacc gaagaggaat catcggaagc
     701  tgaacttcct ttggtatacc tccacgattt cgaattaaac attaacaaga
     751  gagggaaaat tgaagcttca tacgtcgact ttatgtcttg tatgactagg
     801  ttaaaaccta gttcggtttc ttatactcga gtgagttcag aaaaatcttc
     851  cgaagacttt tctttaccag gctcgggaaa gactttcggt tctaaaattc
     901  ttaatcgtaa agtgacgttt acgttcgaaa acggaatcca acttgtgttc
     951  gggatgtatg gactcgaaca acggtgcgtt tcttccgact acttgtggtt
    1001  tgaaaacgtt ttcgttggcg cgcactgcgg caccttaacc tattgtctga
    1051  attgcgaatt agacaaaagt ggtggtgaat tagagatttt gaccttttcg
    1101  aaaaatgaag ttcttcttaa aagatggtga aacttctcga gccttgtcta
    1151  ggtctgaatc gctcctacgt cgtgtgaagg aactcggaac gaattcgcaa
    1201  caaagcgaga tttccgaatg cgtcgacgaa ttcaacgaac tggcgagttt
    1251  taatcacttg ttagttacag ttgaacacag ggaatggatg gaacagcatc
    1301  caaaccagtc gtcaaaactc cgcgttccgt cacgaattgg tgaaatgctt
    1351  aaagagatac gcgcgttcct taaagtacgc gtggtaactc ctatgcacaa
    1401  ggaaaccgcc agcgatactc tgaatgcgtt tctagaagag tactgccgaa
    1451  ttactggact cgcccgtgaa gacgctttac gagaaaagat gagaaaagtg
    1501  aagagtgtgg tactatttca tcattcggaa cttttgaagt tcgaagtgac
    1551  tgaaaacatg ttcagctata ctgaactact aaaactgaat ctaagcttga
    1601  gggtgatttc ttctc