Sequence of DPV Furcraea necrotic streak virus

Furcraea necrotic streak virus isolate Cauca, complete genome.

ACC No: FJ768020

Dated: 2010-03-02 | Length: 3966 | CRC: -1531804863

                
ID   FJ768020; SV 1; linear; genomic RNA; STD; VRL; 3966 BP.
XX
AC   FJ768020;
XX
DT   02-MAR-2010 (Rel. 104, Created)
DT   02-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Furcraea necrotic streak virus isolate Cauca, complete genome.
XX
KW   .
XX
OS   Furcraea necrotic streak virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Dianthovirus; unclassified Dianthovirus.
XX
RN   [1]
RP   1-3966
RA   Martinez A.K., Castano M., Lozano I., Morales F.J.;
RT   "Molecular Characterization of Furcraea Necrotic Streak Virus";
RL   Unpublished.
XX
RN   [2]
RP   1-3966
RA   Martinez A.K., Morales F.J.;
RT   ;
RL   Submitted (19-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   Virology Unit, International Center for Tropical Agriculture, Km. 17 Recta
RL   Cali-Palmira, Palmira, Colombia
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3966
FT                   /organism="Furcraea necrotic streak virus"
FT                   /host="Furcraea"
FT                   /isolate="Cauca"
FT                   /mol_type="genomic RNA"
FT                   /country="Colombia"
FT                   /collection_date="Mar-2004"
FT                   /db_xref="taxon:676234"
FT   5'UTR           1. .41
FT   gene            42. .2330
FT                   /gene="gp1"
FT                   /note="FNSVgp1"
FT   CDS             42. .2330
FT                   /codon_start=1
FT                   /transl_except=(pos:765. .767,aa:OTHER)
FT                   /gene="gp1"
FT                   /product="polymerase-associated protein"
FT                   /note="read-through stop codon"
FT                   /protein_id="ACW84407.1"
FT                   /translation="MESLLKTVVPIAEERRSRAVQHTFLEKVGRLLLWVCDMGRNRDAI
FT                   NTAALIEDAYQADVEHVDADEVEDCLEPEVTEDTKYRVSLDEATPVEIYDYQQKVWAGC
FT                   TDPEIALERTIPAPPSRKRARRIKKNKGLRFIRVLVDAARAEFGLPKPTEANRLVVQGF
FT                   MNRFCKEWGVCNSHTTHNVSLALPMVFIPRDEDIVARALLSTRFARQREREGRNAQGEG
FT                   WFNNRFGIGGKAGIRFAPKXGCLDVRPGFSTSVSRGDHPDLVVLPSGRPEKQRLVFRYS
FT                   GLGNDTLLAVHNNSLANLRRGLIERVFYVETPTGLAPPPQPQPGIFNHKLAGFSHAFHK
FT                   HAGSHFPITRERFLMYYRGRKLAVYXNAVESLSLQPICKRDAKLKTFVKAEKINITRKP
FT                   DPAPRVIQPRSPRYNVEVGRFLRPFEHKCFRYIEEVFGEPTVFKGYNMCQQGRLMRQKW
FT                   DXYRDPVAIGLDASRFDQHVSEQALEWEHGMYLRCFRGDAVLKRLLRWQIDNVGVGFAN
FT                   DGIIKYKKTGCRMSGDMNTSLGNCLIMCAMVKSLLEELNVKGSLANNGDDCVIICERKD
FT                   VAGMINKIPSLFPRFWLYHGREKPVDIFEQIEFCQAKPVFDGENYIMVRDPRVALSKDL
FT                   TCLLPLTKTAQFKEWFTAISTCGLALTGGIPIWQSFYRALDQKQKLTGFTLRTHFVESG
FT                   IAYHSKTMHRKDRPVDPRARESFYLAYGVTPDLQEAVELWYDNIQMDFSDPVPRDTRQR
FT                   IESSLLHGV"
FT   gene            42. .767
FT                   /gene="gp2"
FT                   /note="FNSVgp2"
FT   CDS             42. .767
FT                   /codon_start=1
FT                   /gene="gp2"
FT                   /product="polymerase-associated protein"
FT                   /note="ORF1"
FT                   /protein_id="ACW84408.1"
FT                   /translation="MESLLKTVVPIAEERRSRAVQHTFLEKVGRLLLWVCDMGRNRDAI
FT                   NTAALIEDAYQADVEHVDADEVEDCLEPEVTEDTKYRVSLDEATPVEIYDYQQKVWAGC
FT                   TDPEIALERTIPAPPSRKRARRIKKNKGLRFIRVLVDAARAEFGLPKPTEANRLVVQGF
FT                   MNRFCKEWGVCNSHTTHNVSLALPMVFIPRDEDIVARALLSTRFARQREREGRNAQGEG
FT                   WFNNRFGIGGKAGIRFAPK"
FT   gene            2203. .2523
FT                   /gene="gp3"
FT                   /note="FNSVgp3"
FT   CDS             2203. .2523
FT                   /codon_start=1
FT                   /gene="gp3"
FT                   /product="movement protein"
FT                   /note="ORF3"
FT                   /protein_id="ACW84409.1"
FT                   /translation="MVSHQISRKLLSSGMTTYKWISVTRSPVIRANVSKALFYMEYNIQ
FT                   SDGERVVRTRRPVKDRDNKLSGVKEQAVGQTSQKSHQGQGNGVMTNIAETQTITVTYNF
FT                   NF"
FT   gene            2525. .2695
FT                   /gene="gp4"
FT                   /note="FNSVgp4"
FT   CDS             2525. .2695
FT                   /codon_start=1
FT                   /gene="gp4"
FT                   /product="movement protein"
FT                   /note="ORF4"
FT                   /protein_id="ACW84410.1"
FT                   /translation="MKCRCCDNEPTLSPLFPFFAILVLVLAILVVGTPHVQYQSDQHHN
FT                   ESKIQHITIGK"
FT   gene            2695. .3729
FT                   /gene="gp5"
FT                   /note="FNSVgp5"
FT   CDS             2695. .3729
FT                   /codon_start=1
FT                   /gene="gp5"
FT                   /product="coat protein"
FT                   /note="ORF5"
FT                   /protein_id="ACW84411.1"
FT                   /translation="MSSKKVKQRSGGLQPPPMKRDASSTKTPLKVTAPVAMSRLMVSRT
FT                   PKFSSRSNNITVSHCELVANVTNTTGVLQINNAITSSIGGVYKVNPAQGLFAWLSTLAA
FT                   NFDTYRFDKLIFRYVPMCATTETGRVVMMWDKDSEDPPPNDRFAISSYQHHCSFPCWGE
FT                   GPLTIPVDGVKRFINDEAVVDRKLIDFGQFMFGVYGGSSTNSIGDIYVDYTVTLMEAQP
FT                   TATLTFSTDGNSSVVANRNGPEIGQVFSSTNSITCKLYFAGTYLITIRAVTTATNPVFT
FT                   ILGNCTQLGNLHGVSNGSEWVGYATVSCSGVRSLLDSFTVITLTALGIYQVYVARISPS
FT                   QAGL"
FT   3'UTR           3730. .3966
XX
SQ   Sequence 3966 BP; 1059 A; 929 C; 1019 G; 953 T; 6 other;

fj768020 Length: 3966  02-MAR-2010  Type: N  Check: 4239  ..

       1  tatagtctag ccagctatac cacacaacca aagtgtataa aatggagtct
      51  ctgttaaaga ctgtcgtccc tatcgctgag gaacgtcgat ccagggctgt
     101  tcaacatacc ttccttgaga aggttggccg attattactg tgggtttgtg
     151  acatgggtcg caaccgagat gcgattaaca ccgcagctct cattgaagac
     201  gcatatcagg cagatgttga acacgtggac gctgatgaag tcgaggattg
     251  tttggaaccg gaggttactg aggataccaa ataccgggta tcccttgatg
     301  aagccacccc ggttgaaata tacgactatc agcagaaagt ttgggcggga
     351  tgtactgatc ctgagattgc actggagcga accattccag cgcctccatc
     401  taggaaacga gcccggagaa tcaagaagaa caarggtctt cgattyatcc
     451  gtgtcctagt ggatgcagcg cgggccgaat ttggactccc gaagcccacc
     501  gaagctaacc gcttggtggt acaggggttc atgaacaggt tctgcaagga
     551  atggggggtt tgcaactctc acaccactca caatgtgtca ctggcactac
     601  ccatggtttt cattcccagg gatgaagata tcgtggctag agcgctattg
     651  agcacccgtt ttgccaggca acgtgagagg gagggtcgga atgcgcaggg
     701  tgagggctgg tttaacaacc ggtttgggat tgggggtaaa gcgggtatcc
     751  gctttgcccc caaatagggg tgcctagatg tcaggccagg gttctccacg
     801  agtgtttcac gtggagatca cccagacttg gtggtattgc catcaggacg
     851  ccccgagaaa cagcggctgg ttttccgcta tagtggactg ggcaacgaca
     901  ccctactcgc cgtccacaac aactcactcg ccaatcttag gagaggcctc
     951  attgagcgag tgttttatgt ggagacgcca acaggattgg cgcctccccc
    1001  tcagccccaa cccggcatat tcaatcataa attagccggg ttttcgcatg
    1051  cttttcacaa acaygccggt tctcattttc ctataaccag ggagcgattc
    1101  ctgatgtatt ataggggcag gaaactagct gtttatwcca atgcagtgga
    1151  gagtctttcc ctccaaccta tctgcaaacg agatgcgaaa ttgaaaacgt
    1201  ttgtaaaagc cgagaagatc aacatcacac gcaagccaga tccggctccg
    1251  cgtgtgatcc aacctcgatc acctcggtat aacgttgaag tggggcggtt
    1301  tcttcgtccg tttgaacaca aatgcttcag atacatagaa gaagttttcg
    1351  gggaaccaac ggtgtttaag gggtataaca tgtgtcaaca agggaggtta
    1401  atgcgccaga aatgggatck gtayagagat ccagttgcaa ttggtttgga
    1451  cgcttcccgg tttgaccaac atgttagtga gcaagcttta gaatgggaac
    1501  acggaatgta cctccggtgc tttcgcggtg atgcagttct aaagagattg
    1551  ttgagatggc aaatagacaa cgtgggcgtg ggattcgcaa atgatggaat
    1601  tattaaatac aagaagactg gatgtcgcat gtcaggagat atgaacacgt
    1651  cattgggcaa ctgcttaata atgtgtgcca tggtgaaaag cctgctagag
    1701  gaactaaatg tgaagggtag cctcgccaac aatggcgacg attgcgtgat
    1751  catctgtgag aggaaggatg tggctgggat gatcaacaaa ataccctcat
    1801  tatttcctag attttggctt taccatggtc gtgaaaagcc tgttgacatc
    1851  tttgaacaaa tcgaattctg tcaagccaaa ccagtctttg atggtgaaaa
    1901  ttacatcatg gttcgagacc cacgagtagc cctatccaag gatttgactt
    1951  gtctattgcc cttaacaaaa accgcacaat tcaaagagtg gttcacagcc
    2001  atatctacat gcggccttgc tctcacggga ggaatcccaa tctggcagag
    2051  tttttatcga gcattggatc aaaagcaaaa actcaccgga ttcaccctac
    2101  gaacccattt tgtggaaagc gggatagcct atcactccaa aacgatgcat
    2151  cggaaggata gacccgtaga cccaagggcc agggaatcat tttatctcgc
    2201  ctatggtgtc acaccagatc tccaggaagc tgttgagctc tggtatgaca
    2251  acatacaaat ggatttcagt gacccggtcc cccgtgatac gcgccaacgt
    2301  atcgaaagct ctcttctaca tggagtataa cattcaaagc gacggagaac
    2351  gtgttgtgcg tactcgaaga cctgtaaagg atcgagacaa caagctgagt
    2401  ggcgtgaagg aacaagccgt gggacaaaca tcccagaaat cgcaccaggg
    2451  tcagggtaat ggtgttatga caaacatcgc tgaaacccaa accattacgg
    2501  tgacctacaa tttcaacttt tgagatgaag tgtcggtgct gtgataacga
    2551  gccaacgttg tcacccttgt ttcccttctt tgccattctg gtcttggtgt
    2601  tagcaatact ggtagttggg actccccacg tgcagtacca gtccgatcag
    2651  caccacaacg agtctaagat acagcacatc acaataggaa agtaatgtcg
    2701  tcaaagaaag taaagcaacg gagcggtggg ctgcaaccac ccccgatgaa
    2751  acgagatgcc agctccacca aaaccccact gaaagtgact gctccggtag
    2801  ccatgagtag gttgatggtg agtcgcactc ctaagttcag cagtcgaagt
    2851  aacaacatca cagtttcaca ctgtgaattg gttgctaatg ttaccaatac
    2901  cacaggcgta ttgcaaatca acaatgcaat aaccagtagt ataggtggag
    2951  tctacaaagt caatcccgct caggggttgt ttgcgtggct ctctacgtta
    3001  gcagctaact tcgacactta tcggtttgat aagctgatct ttcggtatgt
    3051  gccgatgtgt gctacgactg aaacagggcg ggtcgtgatg atgtgggata
    3101  aggattccga ggatccccca ccaaatgatc gattcgccat ctccagttac
    3151  cagcaccact gctcctttcc ctgttgggga gaggggccac tcactatccc
    3201  agtagatggg gttaaacgct tcatcaatga tgaagctgtt gtggaccgca
    3251  aactgattga cttcggtcaa ttcatgtttg gggtctatgg tggaagttca
    3301  acaaacagta taggagacat ttatgtcgac tatactgtaa cactgatgga
    3351  ggcgcaacct acagcgactc tcacattcag cacagatgga aatagttccg
    3401  tagtggccaa tcggaatggc cccgaaattg gacaagtgtt ttcgagcaca
    3451  aattcaatca cgtgcaaatt gtattttgca ggaacttatc tcatcaccat
    3501  ccgagcggtt accacagcaa ccaatcctgt atttaccatc cttggtaatt
    3551  gcacccagct gggaaatctg cacggagtgt cgaatggatc ggaatgggtt
    3601  gggtacgcta cagtctcctg ttcaggagta cgaagcttac tagattcatt
    3651  taccgtcatc acgttgactg cattaggcat ttatcaggtc tacgtggcta
    3701  ggatctctcc tagccaggct ggtctatagc tgctttcttt gatgggcggt
    3751  ctggcgagtc ctaaatggcg aaccctttga ccctaagcgc accataggcc
    3801  ccgagaacgg gtttaccggg ctggtgtggc aaccagccga cgtccatggt
    3851  tgtttagcgc ttggagtcag tgtcgtcaca gggaccgttg caggtcgagg
    3901  caccccctag atctctaccg aaaggtagag tgagggcggg aggtgtacca
    3951  agtcacgtgg acgctg