Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate LN minor capsid protein gene, complete cds.

ACC No: FJ786018

Dated: 2009-06-10 | Length: 672 | CRC: 1352371652

                
ID   FJ786018; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ786018;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate LN minor capsid protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Meng W., Fei F., Zhou T., Cheng Y.Q., Fan Z.F.;
RT   "Sequence analysis for partial viral protein genes of grapevine
RT   leafroll-associated virus 2 isolate LN";
RL   Unpublished.
XX
RN   [2]
RP   1-672
RA   Wang M., Fei F., Zhou T., Fan Z.F., Cheng Y.Q.;
RT   ;
RL   Submitted (24-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   College of Agriculture and Biotechnology, China Agricultural University,
RL   No. 2 Yuanmingyuan West Road, Haidian District, Beijing 100193, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="grape, Venus Seedless"
FT                   /isolate="LN"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="01-Nov-2008"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="minor capsid protein"
FT                   /protein_id="ACR77733.1"
FT                   /translation="MSSNTSVPVGGLEALETSGVVLTTRKEAVDKFFNELKNENYSSVD
FT                   SSRLSDSEVKEVLEKSKESFKSELASTDEHFVYHIIFFLIRCAKISTSEKVKYVGSHTY
FT                   VVDGKTYTVLDAWVFNMMKSLTKKYKRVNGLRAFCCACEDLYLTVAPIMSERFKTKAVG
FT                   MKGLPVGKEYLGADFLSGTSKLMSDHDRAVSIVAAKNAVDRSAFTGGERKIVSLYDLGR
FT                   Y"
XX
SQ   Sequence 672 BP; 204 A; 129 C; 178 G; 161 T; 0 other;

fj786018 Length: 672  10-JUN-2009  Type: N  Check: 9576  ..

       1  atgagttcca acacaagcgt gccggttggg ggtctcgaag cactcgagac
      51  ctcgggagtc gtgctgacca cgcgaaagga agcggttgat aagtttttta
     101  atgaactaaa aaacgaaaat tactcatcag ttgacagcag ccgattaagc
     151  gattcggaag taaaagaagt gttagagaaa agtaaagaaa gtttcaaaag
     201  cgaactggcc tccactgacg agcacttcgt ctaccacatt atatttttct
     251  taatccgatg tgctaagata tcgacgagtg aaaaggtaaa gtacgttggt
     301  agtcatacgt acgtggtcga cggaaaaacg tacaccgttc ttgacgcttg
     351  ggtattcaac atgatgaaaa gtctcacgaa gaagtacaaa cgagtgaatg
     401  gtctgcgtgc gttctgttgc gcgtgcgaag atctatatct aaccgtcgca
     451  ccaataatgt cagaacgctt taagactaaa gccgtaggga tgaaaggttt
     501  gcctgttgga aaggaatact taggcgccga ctttctttcg ggaactagca
     551  aactgatgag cgatcacgac agggcggtct ccatcgttgc agcgaaaaac
     601  gctgtcgatc gtagcgcttt cacgggtggg gagagaaaga tagttagttt
     651  gtatgatcta gggaggtact aa