Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate LN 19 kDa protein gene, complete cds.

ACC No: FJ786019

Dated: 2009-06-10 | Length: 486 | CRC: -837394556

                
ID   FJ786019; SV 1; linear; genomic RNA; STD; VRL; 486 BP.
XX
AC   FJ786019;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate LN 19 kDa protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-486
RA   Wang M., Fei F., Zhou T., Fan Z.F., Cheng Y.Q.;
RT   "Sequence analysis for partial viral protein genes of grapevine
RT   leafroll-associated virus 2 isolate LN";
RL   Unpublished.
XX
RN   [2]
RP   1-486
RA   Wang M., Fei F., Zhou T., Cheng Y.Q., Fan Z.F.;
RT   ;
RL   Submitted (24-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   College of Agriculture and Biotechnology, China Agricultural University,
RL   No. 2 Yuanmingyuan West Road, Haidian District, Beijing 100193, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .486
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="grape, Venus Seedless"
FT                   /isolate="LN"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="01-Nov-2008"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .486
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /protein_id="ACR77734.1"
FT                   /translation="MEDYEEKSESLILLRTNLNTMLLVVKSDASVELPKLLICGYLRVS
FT                   GRGEVTCCNREELTRDFEGNHHTVIRSRIIQYDSESAFEEFNNSDCVVKFFLETGSVFW
FT                   FFLRSETKGRAVRHLRTFFEANDFFFGSHCGTMEYCLKQVLTETESIIDSFCEERNR"
XX
SQ   Sequence 486 BP; 137 A; 88 C; 117 G; 144 T; 0 other;

fj786019 Length: 486  10-JUN-2009  Type: N  Check: 8304  ..

       1  atggaagatt acgaagaaaa atccgaatcg ctcatactgc tacgcacgaa
      51  tctgaacact atgcttttag tggtcaagtc cgatgctagt gtagagctgc
     101  ctaaactact aatttgcggt tacttacgag tgtcaggacg tggggaggtg
     151  acgtgttgca accgtgagga attaacaaga gattttgagg gcaatcatca
     201  tacggtgatc cgttctagaa tcatacaata tgacagcgag tctgcttttg
     251  aggaattcaa caactctgat tgcgtagtga agtttttcct agagactggt
     301  agtgtctttt ggttttttct tcgaagtgaa accaaaggta gagcggtgcg
     351  acatttgcgc accttcttcg aagctaacga tttcttcttt ggatcgcatt
     401  gcggtaccat ggagtattgt ttgaagcagg tactaactga aactgaatct
     451  ataatcgatt ccttttgcga agaaagaaat cgttaa