Sequence of DPV Grapevine leafroll-associated virus 2

Grapevine leafroll-associated virus 2 isolate LN 24 kDa protein gene, complete cds.

ACC No: FJ786020

Dated: 2009-06-10 | Length: 618 | CRC: 1568127230

                
ID   FJ786020; SV 1; linear; genomic RNA; STD; VRL; 618 BP.
XX
AC   FJ786020;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Grapevine leafroll-associated virus 2 isolate LN 24 kDa protein gene,
DE   complete cds.
XX
KW   .
XX
OS   Grapevine leafroll-associated virus 2
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-618
RA   Wang M., Fei F., Zhou T., Fan Z.F., Cheng Y.Q.;
RT   "Sequence analysis for partial viral protein genes of grapevine
RT   leafroll-associated virus 2 isolate LN";
RL   Unpublished.
XX
RN   [2]
RP   1-618
RA   Wang M., Fei F., Zhou T., Fan Z.F., Cheng Y.Q.;
RT   ;
RL   Submitted (24-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   College of Agriculture and Biotechnology, China Agricultural University,
RL   No. 2 Yuanmingyuan West Road, Haidian District, Beijing 100193, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .618
FT                   /organism="Grapevine leafroll-associated virus 2"
FT                   /host="grape, Venus Seedless"
FT                   /isolate="LN"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /collection_date="01-Nov-2008"
FT                   /db_xref="taxon:64003"
FT   CDS             1. .618
FT                   /codon_start=1
FT                   /product="24 kDa protein"
FT                   /protein_id="ACR77735.1"
FT                   /translation="MRVIVSPYEAEDILKRSTDMLRNIDSGVLSTKECIKAFSTITRDL
FT                   HCAKASYQWGVDTGLYQRNCAEKRLIDTVESNIRLAQPLVREKVAVHFCKDEPKELVAF
FT                   ITRKYVELTGVGVREAVKREMRSLTKTVLNKMSLEMAFYMSPRAWKNAEWLELKFSPVK
FT                   IFRDLLLDVETLNELCAEDDVHVDKVDENGDENHDLELQDEC"
XX
SQ   Sequence 618 BP; 196 A; 112 C; 160 G; 150 T; 0 other;

fj786020 Length: 618  10-JUN-2009  Type: N  Check: 8295  ..

       1  atgagggtta tagtgtctcc ttatgaagct gaagacattc tgaaaagatc
      51  gactgacatg ttacgaaaca tagacagtgg ggtcttgagc actaaagaat
     101  gtatcaaggc attctcgacg ataacgcgag acctacattg tgcgaaggct
     151  tcctaccagt ggggtgttga cactgggtta tatcagcgta attgcgctga
     201  aaaacgttta attgacacgg tggagtcaaa catacggttg gctcaacctc
     251  tcgtgcgtga aaaagtggcg gttcattttt gtaaggatga accaaaagag
     301  ctagtagcat tcatcacgcg aaagtacgtg gaactcacgg gcgtgggagt
     351  gagagaagcg gtgaagaggg aaatgcgctc tcttaccaaa acagttttaa
     401  ataaaatgtc tttggaaatg gcgttttaca tgtcaccacg agcgtggaaa
     451  aacgctgaat ggttagaact aaaattttca cctgtgaaaa tctttagaga
     501  tctgctatta gacgtggaaa cgctcaacga attgtgcgcc gaagatgatg
     551  ttcacgtcga caaagtagat gagaatgggg acgaaaatca cgacctcgaa
     601  ctccaagacg aatgttaa