Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate JMSG2 major coat protein gene, complete cds.

ACC No: FJ792686

Dated: 2010-04-21 | Length: 672 | CRC: -714655559

                
ID   FJ792686; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ792686;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate JMSG2 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Detection and characterization of Citrus tristeza virus stem pitting
RT   isolates in Jamaica";
RL   Eur. J. Plant Pathol. 127(1):1-6(2010).
XX
RN   [2]
RP   1-672
RA   Fisher L.C., McLaughlin W.A., Tennant P.F.;
RT   ;
RL   Submitted (25-FEB-2009) to the EMBL/GenBank/DDBJ databases.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Mexican lime"
FT                   /isolate="JMSG2"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /note="severe strain"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /protein_id="ACS68172.1"
FT                   /translation="MDDETKKLKNKNKETKEGDNVVAAESSFGSVNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGVT
FT                   YTRDGVEVELSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPTGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 122 C; 167 G; 185 T; 0 other;

fj792686 Length: 672  21-APR-2010  Type: N  Check: 4573  ..

       1  atggacgacg aaactaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacaat gttgttgcgg ctgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata gcgatgaacg atgtacgtca gttgggtacc
     151  caacagaatg ctgctttgaa tagagatttg tttcttacct tgaaagggaa
     201  gtatcctaac ttacctgaca aagataaaga ttttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga cgatgatacc
     301  acgggtgtga cgtacactcg ggatggtgtt gaagtggaat tgtctgacaa
     351  actttggaca gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaactaacg atgcccttta tttggctttt
     451  tgtagacaga accgcaactt gagttatggt ggacgtccgt tagatgcagg
     501  aattccaacc gggtatcact acctgtgtgc agatttcttg accggagccg
     551  gcttgactga tttagaatgt gcagtgtaca tacaagccaa agagcaatta
     601  ttaaagaagc gaggggctga tgaggttgta gttactaatg tcaggcagct
     651  tggcaaattt aacacacgtt ga