Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CAM 25 major coat protein gene, complete cds.

ACC No: FJ810849

Dated: 2010-04-21 | Length: 672 | CRC: 878504657

                
ID   FJ810849; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ810849;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate CAM 25 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Detection and characterization of Citrus tristeza virus stem pitting
RT   isolates in Jamaica";
RL   Eur. J. Plant Pathol. 127(1):1-6(2010).
XX
RN   [2]
RP   1-672
RA   Fisher L.C., McLaughlin W.A., Tennant P.F.;
RT   ;
RL   Submitted (07-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Mexican lime"
FT                   /isolate="CAM 25"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /note="severe strain"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /protein_id="ACS68173.1"
FT                   /translation="MDDETKKLKNKNKEAKEGDDVVAAESSFGSVNLHIDPTLITMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLPDKDKDFHIAMMLYRLAVKSSSLQSADDAHGYI
FT                   VHSGGCEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 194 A; 126 C; 169 G; 183 T; 0 other;

fj810849 Length: 672  21-APR-2010  Type: N  Check: 1725  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aagcgaaaga
      51  aggcgacgat gttgtagctg ccgagtcttc tttcggttcc gtaaacttac
     101  acatcgatcc gactttgata acgatgaacg atgtgcgtca gttgggcacc
     151  caacagaacg ctgctttgaa cagagactta ttccttactt tgaaagggaa
     201  gtatcctaac ttacctgata aagataaaga ctttcacata gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcgc tgacgacgcc
     301  cacggttata tcgtacactc gggagggtgt gaagtggatt tgtctgataa
     351  actttggact gacgtcgtgt ttaactctaa gggtattggt aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgcagacaga atcgcaattt gagttatggc ggacgtccgc tagacgcagg
     501  gattccggcc gggtatcatt acttgtgtgc ggatttcttg actggagctg
     551  gtttgactga cttagaatgt gctgtgtaca tacaagctaa agaacaatta
     601  ttgaagaagc gaggggctga tgaagtcgta gttactaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga