Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CLLR 5 major coat protein gene, complete cds.

ACC No: FJ810850

Dated: 2010-04-21 | Length: 672 | CRC: 1255884852

                
ID   FJ810850; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FJ810850;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 2)
XX
DE   Citrus tristeza virus isolate CLLR 5 major coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Fisher L.C., Tennant P.F., McLaughlin W.A.;
RT   "Detection and characterization of Citrus tristeza virus stem pitting
RT   isolates in Jamaica";
RL   Eur. J. Plant Pathol. 127(1):1-6(2010).
XX
RN   [2]
RP   1-672
RA   Fisher L.C., McLaughlin W.A., Tennant P.F.;
RT   ;
RL   Submitted (07-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Life Sciences, University of the West Indies, Mona Campus, 2 St. John's
RL   Close, Kingston 7, Jamaica
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Mexican lime"
FT                   /isolate="CLLR 5"
FT                   /mol_type="genomic RNA"
FT                   /country="Jamaica"
FT                   /note="severe strain"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="major coat protein"
FT                   /protein_id="ACS68174.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTKDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFST
FT                   R"
XX
SQ   Sequence 672 BP; 198 A; 127 C; 167 G; 180 T; 0 other;

fj810850 Length: 672  21-APR-2010  Type: N  Check: 1404  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcagttaag agttcatcat tacaaagcga cgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtagatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggg agaactaagg atgcccttta cttagctttt
     451  tgtagacaaa atcgcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattt agcacacgtt ga