Sequence of DPV Carnation mottle virus

Carnation mottle virus, complete genome.

ACC No: FJ843021

Dated: 2010-03-25 | Length: 4003 | CRC: 2034538485

                
ID   FJ843021; SV 1; linear; genomic RNA; STD; VRL; 4003 BP.
XX
AC   FJ843021;
XX
DT   25-MAR-2010 (Rel. 104, Created)
DT   25-MAR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Carnation mottle virus, complete genome.
XX
KW   .
XX
OS   Carnation mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-4003
RA   Chen Y.-K., Chang Y.-S., Chen C.-C.;
RT   "Occurrence of Carnation mottle virus infecting lisianthus in Taiwan";
RL   Unpublished.
XX
RN   [2]
RP   1-4003
RA   Chen Y.-K., Chang Y.-S.;
RT   ;
RL   Submitted (18-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, National Chung Hsing University, 250 Kuo Kuang Road,
RL   Taichung 402, Taiwan
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4003
FT                   /organism="Carnation mottle virus"
FT                   /host="Eustoma grandiflorum (lisianthus)"
FT                   /lab_host="Nicotiana benthamiana"
FT                   /mol_type="genomic RNA"
FT                   /country="Taiwan"
FT                   /collected_by="Ching-Chung Chen"
FT                   /collection_date="Jun-2006"
FT                   /identified_by="Y.K. Chen and C.C. Chen"
FT                   /db_xref="taxon:11986"
FT   5'UTR           1. .69
FT   CDS             70. .2679
FT                   /codon_start=1
FT                   /transl_except=(pos:805. .807,aa:OTHER)
FT                   /transl_except=(pos:2359. .2361,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="RdRp"
FT                   /protein_id="ADA69469.1"
FT                   /translation="MGLPSLLVEGVIGCTLVGGLVAVGSAALAVRATIGVVEFNRECVR
FT                   GARRIVSSGGKCLIVQSPYGNPNQGLIRGEDEEIDNVEESTPEELTQLIEVKAEVDGKE
FT                   VVVSKKRVVNRHLRQRFVRSIAIEAKNHFGGDISPSKANYLSVSKFLTGKCKERHVVPA
FT                   HTRDCVSAAMVLVFTPDVHEIRMMAGLASDAAYGRKIAMASILNRKGWCWRLMVNPLDR
FT                   ARWWEMWCVVNGFDSNKPVTFPKXGGLFYLNGVETKIRRGGHPSVIEVDGQCPPKERKL
FT                   YVQNAITTGYEYRVHNHSYANLRRGLLERVFYVERNKELVSCPQPEPGSFKEMGYLRRR
FT                   FHRVCGNHSRISANDLVDCYQGRKRTIYENAAASLLDRAIERKDGDLKTFIKAEKFNVN
FT                   LKSDPAPRVIQPRSPRYNVELGRYLKKYEHHAYKALDKIWGGPTVMKGYTTEEVAQHIW
FT                   SAWNQFQTPVAIGFDMSRFDQHVSVAALEFEHSCYLACFEGDAHLANLLKMQLVNHGVG
FT                   FASNGMLRYTKEGCRMSGDMNTALGNCLLACLITKHLMKIRSRLINNGDDCVLICERTD
FT                   IDYVVSNLTTGWSRFGFNCIAEEPVYEMEKIRFCQMAPVFDGAGWLMVRDPLVSMSKDS
FT                   HSLVHWNNETNAKQWLKSVGMCGLRIAGGVPVVQEFYQKYVETAGNVRENKNITEKSSS
FT                   GFFMMADRAKRGYSAVSDECRFSFYQAFGITPDQQIALEGEIRSLTINTNVGPQCEAAD
FT                   SLWILNRKYQXLESKCSLEIEENKRHVDRWPRMPSVNLHLIVLTGVIGLMLLIRLRCTF
FT                   TSTFSLPPLVTLNQIIALSFCGLLLNSISRAERACYYNYSVDSSKRQHISISTPNGK"
FT   CDS             2334. .2519
FT                   /codon_start=1
FT                   /product="P7 protein"
FT                   /protein_id="ADA69470.1"
FT                   /translation="MDIESEVPVVGKQMLAGNRGKQKTRRSVAKDAIRKPASDSTNGGN
FT                   WVNVADKIEVHIHFNF"
FT   CDS             2425. .2679
FT                   /codon_start=1
FT                   /product="P9 protein"
FT                   /protein_id="ADA69471.1"
FT                   /translation="MPSVNLHLIVLTGVIGLMLLIRLRCTFTSTFSLPPLVTLNQIIAL
FT                   SFCGLLLNSISRAERACYYNYSVDSSKRQHISISTPNGK"
FT   CDS             2669. .3715
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADA69472.1"
FT                   /translation="MENKGEKIAMNPTVQTLAQKGDTLAVKLVTRGWASLSTNQKRRAE
FT                   MLAGYTPAVLAFTPRRPRMTNPPPRTSRNSPGQAGKSMTMSKTELLSTVKGTTGVIPSF
FT                   EDWVVSPRNVAVFPQLSLLATNFNKYRITALTVKYSPACSFETNGRVALGFNDDASDTP
FT                   PTTKVGFYDLGKHVETAAQTAKDLVIPVDGKTRFIRDSASDDAKLVDFGRIVLSTYGFD
FT                   KADTVVGELFIQYTIVLSDPTKTAKISQASNDKVSDGPTYVVPSVNGNELQLRVVAAGK
FT                   WCIIVRGTVEGGFTKPTLIGPGISGNVDYESARPIAVCELVTQMEGQILKITKTSAEQP
FT                   LQWVVYRV"
FT   3'UTR           3716. .4003
XX
SQ   Sequence 4003 BP; 1128 A; 867 C; 1086 G; 922 T; 0 other;

fj843021 Length: 4003  25-MAR-2010  Type: N  Check: 401  ..

       1  gggtaagctg gcgggcaaac ctacactcta tcttagttac attatatatt
      51  ccaaccatct gctttcacta tgggattacc cagtctacta gtggaaggcg
     101  ttattggatg cactctagtc ggtggtttgg tggctgtggg tagcgcagcg
     151  ctggccgttc gggcgaccat cggtgttgta gaattcaata gggagtgtgt
     201  gcgcggggcg agaaggatcg tatctagcgg aggaaagtgc ttaatagtcc
     251  aatcccctta tggtaatcct aaccaaggat tgataagagg tgaagacgaa
     301  gaaattgaca atgtggagga gtcaacaccg gaggaattga ctcagttgat
     351  tgaggttaag gcggaagtgg atgggaaaga ggtggtcgtc tccaagaagc
     401  gtgtagttaa caggcacttg agacaacgat tcgtccgctc catagccatc
     451  gaagccaaaa atcacttcgg cggtgatatc agccctagca aggccaacta
     501  cctttccgtt tccaagtttc tgacgggaaa atgcaaggag agacatgttg
     551  tgcccgctca cactagggat tgtgtgagtg ctgccatggt gctggtgttc
     601  acccccgacg tccacgagat caggatgatg gcaggattgg cgtctgacgc
     651  agcgtacgga agaaagatcg caatggcaag catactgaac aggaaagggt
     701  ggtgttggag gctaatggta aatccattag atagggcaag atggtgggaa
     751  atgtggtgcg ttgtaaacgg gtttgactcc aacaaacccg tcacctttcc
     801  aaaatagggg ggcctgttct acctcaatgg tgtggagacg aaaattcgtc
     851  gtggaggcca cccatcagtg attgaggtag acgggcaatg tcctcccaaa
     901  gagagaaaac tctacgtaca gaatgccata accactggtt atgaatacag
     951  ggtccacaac cattcgtacg caaacctcag acgagggctc cttgagagag
    1001  ttttctatgt tgagcgcaac aaggagctag tcagctgtcc gcaacctgaa
    1051  cccggcagct ttaaagagat gggatacctg cgacgcaggt tccatagagt
    1101  gtgtggtaat cattcccgga tctctgccaa tgatttggta gattgttatc
    1151  agggcaggaa acgcacgatc tatgagaatg cagcagcgtc cctacttgat
    1201  agagctatcg aaaggaagga tggcgatctc aaaaccttta ttaaggcgga
    1251  gaaattcaac gtgaatctga aaagtgatcc tgctcctcgg gttatacaac
    1301  ccaggagccc tcgctacaat gtggagttgg gccggtactt aaagaagtat
    1351  gaacaccatg cttacaaagc cttagacaag atctggggag gaccaacagt
    1401  catgaaagga tacactacag aggaggtagc acagcacatt tggagcgcat
    1451  ggaatcaatt ccagacacct gtggccatag gatttgatat gtcaagattc
    1501  gatcagcatg tgtctgtagc cgcgctcgag ttcgaacatt catgctattt
    1551  agcctgtttt gaaggggacg cacatctcgc caacttgctt aagatgcaac
    1601  tggtgaatca tggcgtgggt tttgcgagta atggaatgtt gcgatacacg
    1651  aaggaagggt gcagaatgag cggtgacatg aacactgcct tgggcaactg
    1701  tttgttggct tgccttatca ccaaacactt aatgaaaatc aggagcagac
    1751  tgatcaacaa tggggatgac tgcgtgctta tttgcgaaag aacagacatc
    1801  gactacgtcg tgagtaattt aacgacggga tggagtcgat ttggattcaa
    1851  ttgcatagca gaagagccag tgtacgaaat ggaaaagatc aggttctgcc
    1901  agatggcacc ggtgtttgat ggagcaggct ggctgatggt cagagaccct
    1951  ttggtgagca tgagcaagga ttctcactcc ctagtgcatt ggaacaacga
    2001  gacgaatgca aaacaatggc tgaagtcagt aggaatgtgc ggtctgcgga
    2051  ttgccggggg ggttccagtt gtgcaagagt tctaccaaaa atacgttgaa
    2101  acagccggaa atgtgagaga gaacaaaaat atcacagaga agagtagttc
    2151  tgggttcttt atgatggcgg atcgcgctaa gcggggctat tctgctgtgt
    2201  ctgatgagtg ccggtttagc ttctaccagg ctttcggcat cacgccagac
    2251  cagcagatcg cattggaggg tgagatcagg tctctcacta tcaacaccaa
    2301  cgtggggccc cagtgtgaag cggcagattc actatggata ttgaatcgga
    2351  agtaccagta gttggaaagc aaatgctcgc tggaaataga ggaaaacaaa
    2401  agacacgtag atcggtggcc aaggatgcca tccgtaaacc tgcatctgat
    2451  agtactaacg ggggtaattg ggttaatgtt gctgataaga ttgaggtgca
    2501  cattcacttc aacttttagt ttgcccccac tggtaacttt aaatcagata
    2551  atagcgttgt cattttgtgg tcttctatta aacagcatct ctcgggcaga
    2601  aagagcttgc tactacaact actctgttga tagttctaaa cgacaacaca
    2651  tttcaataag tacaccaaat ggaaaataaa ggagaaaaga tcgcgatgaa
    2701  tcccactgtg caaacattgg cgcagaaggg ggacacgtta gccgtgaagt
    2751  tggtgacaag ggggtgggcc tctctgagta cgaaccagaa gaggagagct
    2801  gaaatgcttg ctggatacac tccagcggtc ctagccttca caccccgacg
    2851  accacggatg acaaaccctc ctccaagaac cagtaggaat tcaccaggac
    2901  aagctggaaa gtccatgacg atgagtaaga ccgaactatt aagcaccgtc
    2951  aaaggtacca caggtgttat cccaagcttt gaagactggg tcgtttcccc
    3001  ccgaaacgta gccgtcttcc ctcaactctc gctgctggcg acaaacttca
    3051  acaagtaccg catcactgcg cttactgtga agtactcacc cgcgtgcagc
    3101  ttcgagacca atgggagggt ggctctggga ttcaacgatg acgcttcgga
    3151  cacaccacca accaccaagg ttggatttta cgatctgggc aaacatgtgg
    3201  aaactgctgc acagacagct aaggatctag tgataccagt agacggtaaa
    3251  acccggttca tcagggactc ggctagtgat gatgccaaac tagtcgattt
    3301  tggacgaatc gtcttgtcaa catacgggtt tgacaaggct gatactgtgg
    3351  tgggcgaatt gtttatacag tacacgattg tgctgagtga cccaaccaag
    3401  acggccaaaa tttcacaggc aagcaacgat aaggtgtcgg acggaccaac
    3451  gtatgtggtc ccttcggtta atggcaacga gctacaacta agagtggtag
    3501  ccgctgggaa atggtgcatt atagtgcggg gtacggttga gggaggcttc
    3551  accaaaccca cacttattgg gccgggaatc agcggtaatg tggactatga
    3601  aagtgccaga cctatcgccg tttgtgaatt ggtgacacaa atggagggcc
    3651  agatattgaa aatcaccaaa acctcagcag aacaacctct ccaatgggtt
    3701  gtttataggg tgtgaatgca atagaaaagt ttgttagaca cacacggcgg
    3751  gacgtgttgc cggagctgcc actcccccca agatggatcg atattaacca
    3801  tctttggcaa cagcgtgcgt gactaaccga acctagtaat tgcatagcat
    3851  tcgactgtaa cctgttctct gctgaatacg agggtggcct cgtgatccca
    3901  aaccataaaa gaaaccaact tgttggtgga agggcttgga agtaggatca
    3951  accactgttt attaactagg ggtgagagta ttcactgtac tctttccccg
    4001  ccc