Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 12-4 p23 gene, complete cds.

ACC No: FJ860136

Dated: 2009-04-26 | Length: 633 | CRC: 509280036

                
ID   FJ860136; SV 1; linear; genomic RNA; STD; VRL; 633 BP.
XX
AC   FJ860136;
XX
DT   26-APR-2009 (Rel. 100, Created)
DT   26-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 12-4 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-633
RA   Scott K.A., Pietersen G.;
RT   "Characterization of the p23 gene of South African Citrus tristeza virus
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-633
RA   Scott K.A., Pietersen G.;
RT   ;
RL   Submitted (25-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, University of Pretoria, Lunnon Rd, Pretoria, Gauteng 0002,
RL   South Africa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .633
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="12-4"
FT                   /mol_type="genomic RNA"
FT                   /country="South Africa"
FT                   /collection_date="02-Oct-2008"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACP19713.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEVKTVSLEADRLEFLRKMNPFI
FT                   IDALIRKTNYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQAEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGITAKAMLPDIDAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 633 BP; 192 A; 123 C; 160 G; 158 T; 0 other;

fj860136 Length: 633  26-APR-2009  Type: N  Check: 1298  ..

       1  atggacgata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagcactg aagtcaaaac cgtaagtttg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct ttattatcga cgccttgata
     151  cggaaaacca attatcaggg tgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgagg actgaacgta
     251  agtgtaaagt caacaataca caatctcagg ccgaggtggc gcatatgtta
     301  atgcacgatc ccgtgaaata tttaaataaa agaaaagcta gagctttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcatacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaggaaact ccggaacatt ataagttcgg
     501  tataactgct aaggcaatgt taccggacat cgacgctata gacgttggtg
     551  ataacgagga cacttcgtcg gaatacccag tgagtctgag tgtttcaggc
     601  ggagttctcc gtgaacacca cttcatctga ttg