Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate 12-7 p23 gene, complete cds.

ACC No: FJ860139

Dated: 2009-04-26 | Length: 630 | CRC: 1427449304

                
ID   FJ860139; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   FJ860139;
XX
DT   26-APR-2009 (Rel. 100, Created)
DT   26-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate 12-7 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Scott K.A., Pietersen G.;
RT   "Characterization of the p23 gene of South African Citrus tristeza virus
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Scott K.A., Pietersen G.;
RT   ;
RL   Submitted (25-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, University of Pretoria, Lunnon Rd, Pretoria, Gauteng 0002,
RL   South Africa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="12-7"
FT                   /mol_type="genomic RNA"
FT                   /country="South Africa"
FT                   /collection_date="29-Aug-2006"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACP19716.1"
FT                   /translation="MDDTSGQTFISVNLSDESNTASTEIKTVSSEADRLEFLRKMNPFI
FT                   IDALIRKNSYQGARFRARIIGVCVDCGRKHDKASRTERKCKVNNTQSQAEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIDLVMHTKERQLAVDLAAEREKTRLARRHPMRSPEETPEH
FT                   YKFGITAKAMLPDINAIDVGDNEDTSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 194 A; 129 C; 156 G; 151 T; 0 other;

fj860139 Length: 630  26-APR-2009  Type: N  Check: 6232  ..

       1  atggacgata ctagcggaca aacttttatt tctgtgaacc tttctgacga
      51  aagcaacaca gctagtactg aaatcaaaac cgtaagttcg gaagcggatc
     101  gcttggaatt tttacggaaa atgaatccct tcattatcga cgctttgata
     151  cggaaaaata gttatcaagg cgctcgcttt cgcgcgagaa taataggagt
     201  gtgcgtggat tgtggtagaa aacacgataa ggcatcgaga actgaacgta
     251  agtgtaaggt caacaatacg cagtctcagg ccgaggtggc gcatatgtta
     301  atgcacgatc ccgtaaaata tttaaataaa agaaaagcta gagccttttc
     351  taacgcagag atgtttgcga tcgatttggt tatgcacacc aaagaaaggc
     401  aattagcggt tgatttggcc gctgaaaggg agaagacgag attggctcgt
     451  agacacccga tgcgttctcc ggaagagact ccggaacatt ataaattcgg
     501  tatcactgcc aaggcaatgt taccggacat caacgctata gacgttggcg
     551  ataacgaaga cacctcgtcg gagtacccag taagtctgag tgtttccggc
     601  ggagttctcc gtgaacacca cttcatctga