Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate GFMS 35 p23 gene, complete cds.

ACC No: FJ860146

Dated: 2009-04-26 | Length: 630 | CRC: -490596463

                
ID   FJ860146; SV 1; linear; genomic RNA; STD; VRL; 630 BP.
XX
AC   FJ860146;
XX
DT   26-APR-2009 (Rel. 100, Created)
DT   26-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate GFMS 35 p23 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-630
RA   Scott K.A., Pietersen G.;
RT   "Characterization of the p23 gene of South African Citrus tristeza virus
RT   isolates";
RL   Unpublished.
XX
RN   [2]
RP   1-630
RA   Scott K.A., Pietersen G.;
RT   ;
RL   Submitted (26-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Microbiology, University of Pretoria, Lunnon Rd, Pretoria, Gauteng 0002,
RL   South Africa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .630
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="GFMS 35"
FT                   /mol_type="genomic RNA"
FT                   /country="South Africa"
FT                   /collection_date="29-Aug-2006"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .630
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ACP19723.1"
FT                   /translation="MDDTSGQTFVSVNLSDESNTASTRVENVKSEADRLEFLRKMNPLI
FT                   IDALVRKTNYQGARFRARIIGVCVDCGRKHDKALKTERKCKVNNTQSQNEVAHMLMHDP
FT                   VKYLNKRKARAFSNAEMFAIELVLYTKERQLAVDLAAEREKTRLARRHPIRSPEETPEH
FT                   YKFGMTAKAMLPDINAVDVGDNEETSSEYPVSLSVSGGVLREHHFI"
XX
SQ   Sequence 630 BP; 188 A; 127 C; 164 G; 151 T; 0 other;

fj860146 Length: 630  26-APR-2009  Type: N  Check: 7886  ..

       1  atggatgata ctagcggaca aactttcgtt tctgtgaacc tttctgacga
      51  aagcaacaca gcgagcacta gagttgaaaa cgtaaaatcg gaagcggatc
     101  gcttggagtt tttacgtaaa atgaatcccc tcattattga cgctctggtg
     151  cggaaaacca attatcaggg cgctcgcttt cgtgcgagaa taataggagt
     201  atgcgtggat tgtggtagaa aacacgacaa ggcgctcaag actgaacgta
     251  agtgtaaggt caacaatacg caatctcaga acgaggtggc gcatatgttg
     301  atgcacgatc ccgttaagta tttgaacaaa agaaaggcta gagccttttc
     351  taacgcagag atgtttgcga ttgaattggt tttgtacacc aaggaaaggc
     401  aattggcggt cgatttagcc gctgaaaggg agaagacgag actggctcgt
     451  agacacccaa tacgttctcc ggaagaaact ccggaacatt ataaattcgg
     501  tatgactgct aaggcaatgt taccggacat caacgccgta gacgttggtg
     551  ataacgagga aacttcgtcg gagtacccag tgagtctgag tgtttctggc
     601  ggagttctcc gtgaacacca cttcatctga