Sequence of DPV Carrot yellow leaf virus

Carrot yellow leaf virus, complete genome.

ACC No: FJ869862

Dated: 2009-08-21 | Length: 16354 | CRC: 524253903

                
ID   FJ869862; SV 1; linear; genomic RNA; STD; VRL; 16354 BP.
XX
AC   FJ869862;
XX
DT   13-JUL-2009 (Rel. 101, Created)
DT   21-AUG-2009 (Rel. 101, Last updated, Version 2)
XX
DE   Carrot yellow leaf virus, complete genome.
XX
KW   .
XX
OS   Carrot yellow leaf virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-16354
RX   PUBMED; 19575278.
RA   Menzel W., Goetz R., Lesemann D.E., Vetten H.J.;
RT   "Molecular characterization of a closterovirus from carrot and its
RT   identification as a German isolate of Carrot yellow leaf virus";
RL   Arch. Virol. 154(8):1343-1347(2009).
XX
RN   [2]
RP   1-16354
RA   Menzel W., Goetz R., Lesemann D., Vetten H.J.;
RT   ;
RL   Submitted (27-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Institute of Epidemiology and Pathogen Diagnostics, Julius Kuehn-Institute,
RL   Messeweg 11-12, Braunschweig 38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .16354
FT                   /organism="Carrot yellow leaf virus"
FT                   /host="Daucus carota L."
FT                   /mol_type="genomic RNA"
FT                   /country="Germany"
FT                   /collection_date="2001"
FT                   /db_xref="taxon:656190"
FT   5'UTR           1. .324
FT   CDS             325. .7620
FT                   /codon_start=1
FT                   /product="polyprotein 1a"
FT                   /protein_id="ACT10242.1"
FT                   /translation="MAIVSTQVQTHFAASFDQTFNAFLSAATFTSPSFYRLSVSQTLSK
FT                   FIDKLSKNKVLVIISPSKNFSFLFQLPSPISSSPLRYHPRKREPCVFYAQDGTIESPVS
FT                   RHTAPSSEKEARKVFDFTRKFHNQNKTKIMILSHDRGDRLYLPLSRKRIINVTSVCGHR
FT                   YTLCAPRERXAHSHRRKTHVPFPRKSADRKKKNKIPVRALNCKPSSEKDAAGKKKNPRK
FT                   GDAFKPKSRNFDIAPRLPDTERISNPSVEVRLKPIPNATFSSRKPYLISESRFLVIGGR
FT                   LGLHATLTGDTDRCFHSMLKYLTCYEPEVDDFIVSFSVNGDRYNIKVRGSGAVDIIPMF
FT                   SDEITTTSASRDYLTTYRMRSRGYIHDSILSRYHAPRGYCYLNHIFFLSLRAGCAFRPA
FT                   KNYFKTLGRNPSATDLSARISAYFGFAAASYHIAGRYTGYNRFHCDNSSRKLYTLEYLR
FT                   EAAVGAEGEDEEVNTSLTDVGRVKALTQVHDSLRANRESLLVKSMEMDLVDFLNTTKNL
FT                   QRGKEKLRVPFMLTEVQQSRLIPAYPHFHISFTSSSASDHPMAAASRLLENRTLVSFCS
FT                   DHFIDVGGCPLHHYYFSKTKRVHVCRPVYDSKDAQRRVLRNTQLKSPLKAPLDEDGSSD
FT                   APFVPSIHTSCAKVIDQCSYSADYMVMVQVYDVPLETLCASMSKRKVSVCYLTMITPGE
FT                   ILDRREAFHHGVLNCDITLDVGSDTITYKFGSSCYTHTLSTITQYMTTPVYSYENNLYS
FT                   IEMTGERCGVNYYVITRSEVSPAIDCQKVIRYRRCCEGLVRAKLPKFCKKTRKCLPGVD
FT                   YVFVDADFVERIHQYVIGNCSVVNSKTFEWTWNYVKSSKSRVVISGKMIQRDVSISLDQ
FT                   MEPMVVVMLAAGVRSRQASEYLAKNVALYTGGASILDVLLFSLKEKYRGLKQSFNDYLT
FT                   TTLKGFFADVLLMEFLDLDDAFTYYDNFSEITVGIKQQGFGAIDDGEVQALLNSRCSSD
FT                   VMNSAIVSSLPPPKNKKSIAKNPTEGPKDPHGRERGLYAAGRRNDVLTSVIDMFLACRD
FT                   ILGNAAADALSLLKGVFSRILKEFGSFGSKLRLLYDSTMSLAAVFSFPPKKTAELLLSA
FT                   FSHFKLVGCSFANSYMRTVKEILNGISAKGDRILQILKSYVSAISSAAHKSHSRIITEM
FT                   KVALDALAEASYFDFHEELPFEVAVSVIQKFVFDIPSMLTGKISPMQCVLRCATNLVFE
FT                   LNLNLAIARIIGPSDTLKKDMFNRTVSSLVSSAFLDRFTFSPETFIRLSTVVPMVVRKL
FT                   LVSFFSDDFSYYVGQVKYGVDDFSAFKYARRNASDAYHSILNSLCRSSESYLDKVIDKF
FT                   VETVKSTLLETLPGKEMYSSLLSLKGGVHARYQSLKKRLTRARRPQTSSDDEEDFFSTS
FT                   EDSELLSEKPGLFGNGPRVQGVISCGVGFVRDLLRSFRRLLSTLFIRCSRHFVANFNLN
FT                   LLSEYSRTIRLEYEDHYLKNTYYLHRLSEDVVQSFQLERSRSQLRVPREVLRTGVCSTV
FT                   KWVVSDLMFFIRRRLTSKSFLYYDLPHVILAFYTLPQSPLFFSLQLGTYVCELLHSDDV
FT                   KLFLKTTYTRVGLSNTTSVTLYPLSHVEPVLEDSPLSETESDESETNDLFRQSTIAEIE
FT                   NLSDENTSTAPGLFGDGHRISLISFIIRQIRQFIKCALSKSSRSLTLIFLLGSVSNSLL
FT                   FSKWSTTFSKFWGLFMVFLYPKSMIFPLVSETILRQKFLTPLRSILRKISAFSSYLEKI
FT                   FYTKRVAFSKIPDKRPAYLPVRAYKSGKEELNGKSSGVASIVESLEKIAHIKQAVKTTM
FT                   KSVERHSETFEGSEISSGYSSSSDEGAAVDQVTQTSPGAADSEKTQLLPIISEFATPRR
FT                   EVKHSASGRKEGLCKYLQSLNICSRPPVPYTQVAPLPGNYSRCTNAVREFYFLQEVSLF
FT                   DLHYKFLRYWEQLKCMDFDRTRTECEMDEDLYVYTSSAMNFAPKKKSRVPLGLAHHEMM
FT                   FTEHGVVLNDPKYRHNKLQHEQLAFVSANAFLRGCEYHSSVVFDNSNVCIMLYEAPPGG
FT                   GKTTSLIDLYFSYTGDFKCLIVTANKNSQIDIKNKVNKRAEKRKAKSGEQASKAKGSGK
FT                   DVMTIDSYLMNYFSSKCDILFVDECFMVHAGQVLAIINASQCRRCILFGDSRQIHFIQR
FT                   NETCSSFYGGLNSFIPPSARVYGEISYRCPWDVCQWLSKVYKNAIKSNNIESLGKSSVA
FT                   IREIEGLDSVPILSGVKYVTFTQGEKSELERFLKPKLPKVEVNTVHEVQGETFSRVALV
FT                   RTKYQEDTPFVSENHIIVALSRHVESLHYYVLSSRCFDDTSRAIKEMMEISEKYKTLPN
FT                   YFSGSSIQMEVTGEPVDNSSCKALSAPLQSLNDFLEEIVPGSTSINFGDPSAEMSVSPF
FT                   ECAVDGVTIHAGDNGSRLHDHDPARV"
FT   CDS             7580. .9016
FT                   /codon_start=1
FT                   /product="1b"
FT                   /note="ORF1b; probably translated via +1 ribosomal
FT                   frameshift, shifty nt sequence 7612-7621"
FT                   /protein_id="ACT10243.1"
FT                   /translation="MAAASTITIRLGFSIVRSQAIPQRKPSLQENLYSYESRNYNFLKC
FT                   DRFSSPEIFGKAMATSVLRKCLDAQKLAEVKKETIAFSQSALLKWMSKRDTSQLKSLQA
FT                   EFGKPLQLDTAIHYFKLMVKRDAIVKLDSTCLTKHPAAQNIMFHAKAVNALYSPCFDEF
FT                   KNRFMSCLLPHIVFFTEMDNRAFASVARGVLGRCAQELFVGEVDFSKFDKSQDIFIKEF
FT                   ERCVYSQLGFDHELLDLWMQGEYQGKATTLDHQLSFNVECQRRSGAANTWIGNSVVTLG
FT                   ILSLYYDLAKMQGVFISGDDSLIFSSQKLSNHSEAICLETGFEAKFMSPSVPYFCSKFL
FT                   VFCEHKFFFVPDPYKLIVKLGQVRSEVEDADLFEIFTSFKDLTKDMHDERVLEYLARLV
FT                   EEKYDVKSRCVLSALHAVHCLGSNFSSFKKLFPKQKGWLTFSRVSKSLLQKISLGVLQQ
FT                   EKYSTAFGENYFLSYTSDDA"
FT   CDS             9039. .9221
FT                   /codon_start=1
FT                   /product="p7"
FT                   /note="contains transmembrane domain"
FT                   /protein_id="ACT10244.1"
FT                   /translation="MDSTLKFLLLFLFCWVCLIFSIVTFICIYLGISTFFYRLPDPELA
FT                   VSANSSFRAPASARV"
FT   CDS             9224. .10015
FT                   /codon_start=1
FT                   /product="p29"
FT                   /note="contains transmembrane domain"
FT                   /protein_id="ACT10245.1"
FT                   /translation="MVETTVYSFDAASGIAQTRIGDFLTILLKNTNVPSSPNRTRRWCV
FT                   WLSLHDKLYEVVFERGVSSHSVYTVDRDISRGGDIYGETRLEVTSFNTARLDLVVLNSV
FT                   VRVFVSVDGKSPVNFETSFIPDHIGFGSESVFSGVEAPDDLQCYATTSYSSSFNFKPSA
FT                   VEKILLTHSPPNLSIFPDSAGSVSRSNERSEAHHSPIAISIDEEDFDVSHFHPNVHTKR
FT                   HAEGEEKQKRKTELFACRNLWIMTIITVFLFILVLVLVSRA"
FT   CDS             10064. .11902
FT                   /codon_start=1
FT                   /product="p67"
FT                   /note="HSP70h"
FT                   /protein_id="ACT10246.1"
FT                   /translation="MVVFGLDFGTTFSTISVLKEGEIYLRKQQNSPYIPTYIFLSEETA
FT                   EVAYGYDAESLMYSRKIKGSFFRDLKRWVGCNEKNFEKYMSLLKPSYKVELSLFGSSDL
FT                   KTVKMHSFNPEGNYSYSLPDLIASFVRCIVYDAELCFKTKCTGIICSVPAGYNSCQRSF
FT                   MLECVTLSGYTCLHIINEPSAAAFSAAPRLGPKDKFVLVYDFGGGTFDVSGVSVRNGTF
FT                   GVRSSGGDMNLGGRDVDRSFVEKLYGKIGGLTPDYSLDVSALKERISSIGNPIVYQLPV
FT                   GGEFRSVEVDSSDLAEVALPLFQRTIKIMTKVHDDYYSSVSSNDKIPRSGKEKKETSDD
FT                   GCVLITVGGSSYLPGLKGLLSAIPYVSRVIELPDARSSVAAGCAMYSLCLAKDSSMLLI
FT                   DCASHHLSIPSYQCESIVLVPAGAPIPFSGRRTISLMNASATSSYNAILFEGDYSKCPM
FT                   NERIYSSAIQLKDLGITAVRPVTRSITIELDVSSVGTITFKVKGEKGAEVTIGKDRMFD
FT                   FSGCHSPTRSVMNLFKNVAERVVLNLVLTRTPEARSRLSLSEVDKLYNENRDYQLQILK
FT                   RDYPNFNDVDTDVCRSLMGVFVQKILRGSRVERLPL"
FT   CDS             11814. .13253
FT                   /codon_start=1
FT                   /product="p54"
FT                   /note="CPh"
FT                   /protein_id="ACT10247.1"
FT                   /translation="MSTPTFAGHSWGCLFKRFYGVPVWKDYLSNTASSNATYVLNTYRF
FT                   NSGHSISASDVAKAGRSSAVYEFYLLLKSETIYKWCETCGIGIQTAFSDYDTNVNSFRS
FT                   NMLIDVDVKTVGCRFSLSDLEAALRPSHPLEIRDKTFLEHCWVLSNSCGEIIDPLDIKR
FT                   FKSITFGDANALGKADETLMIGSSVGDYLSHCLTVLARSKLPSSAGETKMKDDWLAHCI
FT                   TYFSATDLNYSSKEKIPLLTGIIYELIDQHKMFLSSYANNVKNFSVLLGKIVPTIESIW
FT                   TFKWLKKPTDHRLLFEFSLSDLNKSASQVLSLNDMTVVLESKLNLLERVIHHSNIDSLK
FT                   EVVDAILKDENPDIDGETLWICFHCYYGQHRTAAERVQARPEYYEPPFSLKKADSKLKI
FT                   SFVGVEKLFTTLQGQNPGINVRRQFCGRISHEAIFVFKKMGLRFPTIATVIIPPELAYL
FT                   NLDYYKWVDTSQLNPKKRGPC"
FT   CDS             13397. .14077
FT                   /codon_start=1
FT                   /product="p24"
FT                   /note="CPm"
FT                   /protein_id="ACT10248.1"
FT                   /translation="MSKELMIVSPDGSLEKADVSKLAIATRESMQAAFSALDLSSVSGT
FT                   SDSCLSDSELTEAATKVNTELKKITKGEDIDMPSHFAALIARAATIGTSLSAVYRNQQT
FT                   YSIRGKGKYTVKDAEIFPYIIDITAKYGKPNGLRAFFASLENAFLVIAKMKPQLFESRV
FT                   ATRRGTPKEKGYLATDFLSGASPILVDQERAILNSASSYALDRAASKKKNSGLVSLYDY
FT                   GRYD"
FT   CDS             14189. .14812
FT                   /codon_start=1
FT                   /product="p26"
FT                   /note="CP"
FT                   /protein_id="ACT10249.1"
FT                   /translation="MPENDSNDSSNKSALTQTPSKLSSVSISDKRLLTGAVKDAAKIKF
FT                   FTGITAKYPSINIADTNTHLGMLLHGYAIKTTSKQASEPEGEFVNYTLGETEYSFTEKD
FT                   YLNIFDSIPRITGNNEPRVFCRSFATEYLDFFLKNSSTLPNNPRALSQGLPPGYHYLAA
FT                   DFLDACDKLTLHEAAAAVKAKDHALASKQVADQFVANVYEIGKH"
FT   CDS             14818. .15399
FT                   /codon_start=1
FT                   /product="p22"
FT                   /note="hypothetical protein"
FT                   /protein_id="ACT10250.1"
FT                   /translation="MEKLKILTSSHVTTPKRFDHRIIIALENETNFDNYFEATLFLKHK
FT                   EIDAGAEDLPFTFSFKDVVFVSPYSLIRAEGGLISGIEIGTDLHSTVIANISTYMEANV
FT                   RPLRIVNEIPCCESEVVFWFSPHRNITFEVGNGNTNPLTKRSFILTPGGWSNLSFTGNI
FT                   GQCLRFCLTDEGVGKEIIKIFMYTSTLCTK"
FT   CDS             15483. .16127
FT                   /codon_start=1
FT                   /product="p25"
FT                   /note="putative silencing supressor"
FT                   /protein_id="ACT10251.1"
FT                   /translation="MKLYISIYEYIALVSEISRLLDLVSECVSGVTYDKFKEFRYRFVH
FT                   LTMLIPSLKSDLNDSLRDEGFSMQSEKKEQLVLFEKTCSDVQSKLRRMIVQSYSISSPL
FT                   DLVVFFCKKHYEMRCCDYSTIMHDKVKPSCDAVLRDISNTFGVDVSPRSFENGGFLTLK
FT                   DTSFRHLFKDCFGVGEEEIRRLLNERETGSSLFSVEPYVPKYVSEGAESHI"
FT   3'UTR           16128. .16354
XX
SQ   Sequence 16354 BP; 4337 A; 3912 C; 3457 G; 4643 T; 5 other;

fj869862 Length: 16354  21-AUG-2009  Type: N  Check: 9838  ..

       1  gcccgttttt aaaccaattt tctatacgta ccaggtawtc ctaccaatac
      51  gtatactctc caaaagtccc ctcacccatc ggtttttctc ctatacagtt
     101  ggattaaaat cttcccctca tcaatcacct cacccgtcca rtttcccctt
     151  ttttcttttc ctatacagtt ggaatcgaaa atttttccct ttctttcgct
     201  tcgcagtcct ctttccctct cgctcatcgc atcctcactc gtactttgag
     251  ttyttctttc ctctcctcat tttcagtcca atcctaaaaa acaaaacaaa
     301  aatttaaaaa ttaaaaacaa aaatatggct atcgtctcaa ctcaagtcca
     351  aactcatttc gccgcttctt tcgaccaaac cttcaacgct ttcctcagcg
     401  ccgccacctt cacaagtccc agcttctatc gcttgagcgt ttcccagact
     451  ctgagtaaat tcatcgataa gctatcaaaa aacaaagtcc tagtaattat
     501  ctccccttca aaaaattttt cttttctttt tcaactaccc tctcctattt
     551  cttcaagtcc cctacgttac catcccagga agagagaacc ttgtgttttt
     601  tatgctcaag atggaacgat tgaaagtcct gtgtctcgtc acacygctcc
     651  ttcttctgaa aaagaagcta ggaaagtgtt tgacttcacc cgaaagttcc
     701  ataaccaaaa caaaacaaaa ataatgatcc tatcccatga ccggggtgac
     751  cgtttatatc ttcccttatc tcgaaagagg atcataaacg tgacatctgt
     801  ttgcggtcac cgctacaccc tttgcgctcc tcgtgaaagg arcgcgcact
     851  ctcatcgtcg taaaacccac gtcccctttc ctagaaagtc cgctgatcgg
     901  aagaagaaga acaaaattcc cgtaagagct cttaactgca aaccctcgag
     951  cgaaaaggat gcggccggga agaagaaaaa ccccagaaaa ggggatgcct
    1001  ttaaaccgaa atctcgcaac ttcgacatcg cccctcggct acctgatacc
    1051  gagaggattt ctaatccctc cgttgaagtg agacttaaac ccatacccaa
    1101  cgctactttc tcctctagga aaccgtacct tatttccgaa agtaggtttc
    1151  tcgtgatagg cggtcggtta ggccttcacg ccacccttac aggggacacc
    1201  gataggtgtt ttcattctat gttgaaatac ctcacgtgct atgaaccaga
    1251  agtggacgat ttcatagttt ctttttccgt gaatggtgac cgctataata
    1301  taaaggtccg aggctcgggt gccgtcgaca ttattcccat gttttcggat
    1351  gagatcacca ccacatccgc ctctcgcgac tacctgacca cataccgcat
    1401  gaggagccgt gggtatattc acgattctat tctctcccgt taccacgccc
    1451  ctcgcggtta ttgttatctc aatcatattt tctttttatc tttgcgtgct
    1501  ggatgtgcct tccgaccggc gaagaattat ttcaaaacgc tggggcgtaa
    1551  cccttccgct accgacttgt cggctcgtat cagcgcgtac ttcggtttcg
    1601  ctgccgctag ctatcacata gccggtagat ataccggata taaccgtttt
    1651  cattgcgata attcatcgag aaagttatac actttggaat acttgcgcga
    1701  agccgcggtc ggtgctgaag gtgaagatga agaagttaac acatctctaa
    1751  ccgacgtggg acgcgtgaag gccctcactc aagtgcatga cagtttgcgc
    1801  gctaaccgtg aatctctttt agtgaaaagc atggaaatgg atctggtcga
    1851  cttccttaac accacaaaaa atttgcagcg cgggaaagag aaattgcggg
    1901  ttccctttat gcttacggaa gttcagcaaa gccggctcat tccggcgtat
    1951  ccccactttc acatttcttt cactagttct tcagcttctg accacccaat
    2001  ggccgccgct tctcgtcttt tagagaatag aactttggtg agcttctgtt
    2051  ccgatcattt tattgatgtc ggtggatgtc ctcttcacca ctattatttt
    2101  tcgaaaacaa aaagggtgca cgtgtgtcgc cccgtgtacg acagtaagga
    2151  tgctcaaagg cgtgttcttc gcaatactca acttaaatcc cctttgaaag
    2201  ctcctttgga cgaagacggt agtagcgacg caccttttgt cccgtctatt
    2251  catacttctt gcgctaaagt gattgaccaa tgttcatatt ccgctgatta
    2301  tatggtaatg gtgcaagttt acgatgttcc tttagaaacg ctatgcgcta
    2351  gtatgagtaa aagaaaagtt tcagtttgct acctaactat gattactccc
    2401  ggcgagatat tggataggcg cgaagctttt caccacggcg ttctcaattg
    2451  tgacataacg ttggacgtag gttctgatac cataacctac aaattcggtt
    2501  cctcttgcta cacccacacg ttatccacta taacgcagta catgaccacc
    2551  ccagtttact cgtacgaaaa caacctttac tcgatcgaga tgaccggtga
    2601  gaggtgtggt gttaactatt acgtaatcac caggtccgaa gtcagcccgg
    2651  ccatagattg ccaaaaagtt atcaggtatc gccggtgttg tgaaggtctc
    2701  gtgcgcgcta aactccccaa gttttgtaag aaaacgcgga aatgtcttcc
    2751  cggggtggat tatgtttttg tcgatgccga tttcgttgaa aggatccacc
    2801  agtacgtcat tggtaactgt tcggttgtta attcgaagac ttttgaatgg
    2851  acgtggaatt atgtgaagag tagcaagtcc agagtcgtta ttagcggaaa
    2901  aatgattcag cgtgacgttt caatttcttt agatcagatg gaaccgatgg
    2951  tcgtcgtcat gctcgcggcg ggcgtacgtt cgcggcaggc gtctgaatat
    3001  ctcgcgaaga acgtcgcctt gtatacgggc ggcgcttcta tccttgatgt
    3051  attgcttttc tcgttaaaag aaaagtaccg gggtttgaaa caatccttta
    3101  atgactatct cacgaccact ctgaagggtt tcttcgccga tgttctgctt
    3151  atggagtttt tggatttaga tgatgctttc acgtactacg ataatttttc
    3201  tgaaatcacc gtaggcatta agcaacaagg tttcggcgca atagacgatg
    3251  gtgaagttca ggccctactc aatagtagat gttcttcaga tgtaatgaac
    3301  tctgccatcg tttcttctct cccacctccc aaaaacaaga aaagcatcgc
    3351  aaaaaatccc accgaaggtc cgaaggaccc tcatgggagg gaaagaggac
    3401  tctatgcggc ggggagaaga aacgacgttc tcacgtcggt tatcgacatg
    3451  ttcctcgctt gtcgtgacat actaggaaac gccgccgccg acgccctttc
    3501  ccttttaaaa ggagtttttt ctcggattct gaaagaattc ggttcgttcg
    3551  ggtcgaaact acggcttctt tatgactcca ccatgtcgct agccgccgtt
    3601  ttctcttttc cacccaagaa aacagccgaa ctcctcttga gcgcgttctc
    3651  tcattttaaa ctcgtggggt gcagttttgc taattcttac atgcgcaccg
    3701  ttaaagagat tttaaatgga atctcagcaa aaggcgaccg aattcttcaa
    3751  attttaaaat cgtacgtctc ggccatatct tccgcagcac ataagtctca
    3801  tagccgtatc attacggaaa tgaaggttgc tttagatgcc ttagcggaag
    3851  cttcgtactt cgattttcat gaggaacttc cgttcgaagt cgctgtttcc
    3901  gtgattcaga agttcgtttt tgacattcct tccatgctaa cgggaaaaat
    3951  atccccaatg caatgcgttc tccgctgtgc cacgaacctt gtcttcgagc
    4001  tcaacttgaa tctggctatc gctaggatca taggccctag tgacacacta
    4051  aagaaagaca tgttcaatcg cacggtgtcg tctttggtct ccagcgcttt
    4101  cctggaccgt ttcactttct ctcctgaaac ctttatccga ctctccaccg
    4151  tggttcccat ggtggttcgg aaactactgg tctcattctt ttctgacgac
    4201  ttctcttact acgttgggca ggtgaaatat ggtgtcgacg acttctccgc
    4251  ctttaagtat gcgaggagga acgcttcgga tgcgtaccac tctattctaa
    4301  actccctgtg ccgttcttcc gaatcttatt tagataaagt tattgacaaa
    4351  ttcgttgaaa ccgtgaaatc taccttactt gaaacattac ccggaaagga
    4401  aatgtactct tcattgctct cccttaaagg tggggtgcac gcacgttacc
    4451  aatcgttgaa gaagcggcta actcgcgcga ggagaccgca gacttcctct
    4501  gatgatgaag aagatttctt ttcaacctcc gaagactctg aactgttgag
    4551  tgaaaaaccc ggtctctttg gaaacggccc tcgggttcag ggggttatct
    4601  cttgcggcgt ggggtttgtg agagacctcc tccgtagctt ccggcgcctt
    4651  ctttcgactc tttttatcag gtgctctcga cacttcgtgg ccaattttaa
    4701  tttgaattta cttagtgaat actctcgcac gatccgtttg gagtacgaag
    4751  atcattattt aaagaacact tactatttgc ataggctttc tgaagatgtc
    4801  gtgcaatcct tccaattgga aagatctagg tcgcaattac gcgtccctcg
    4851  tgaagtattg cgaaccggtg tttgttcgac ggtaaagtgg gtcgtcagtg
    4901  atttgatgtt tttcatccgc agacgcctta cttccaaatc cttcctgtac
    4951  tatgatttac ctcacgtaat tttagctttt tatactttac cgcaatctcc
    5001  tctcttcttt tcgctccaat tagggactta cgtgtgcgaa ttacttcatt
    5051  cggacgatgt gaaattattc ttaaaaacca cgtacacgcg cgtcggtttg
    5101  tctaacacta catccgtcac gttatacccg ctttcacacg tagaacccgt
    5151  cttagaagac agtcctttgt ctgaaaccga aagcgatgaa tcagagacga
    5201  acgatttatt tcgccaatcc accatagctg aaatcgagaa tctttctgat
    5251  gaaaacactt ctaccgcacc aggtcttttc ggggatggtc acagaatttc
    5301  tctaatttcg tttatcatca ggcaaattag acaatttata aagtgtgcgc
    5351  tatcaaaatc atctagaagt ctcaccctta tctttctttt aggtagtgtt
    5401  tccaactctt tacttttctc taagtggtcg acgacctttt caaaattttg
    5451  gggtttgttc atggtattct tatatcctaa gtcgatgatc ttccccttgg
    5501  tctcggaaac tattcttcgc caaaaatttt tgaccccctt aaggtctatc
    5551  cttagaaaaa tttctgcttt tagctcttac ctcgaaaaaa ttttttacac
    5601  gaagcgagtg gcattttcaa aaatccccga caagagacca gcctatttac
    5651  cagtccgcgc ctacaagtct gggaaagagg agttaaatgg caaatcgtct
    5701  ggtgtcgctt cgatcgtgga atcccttgaa aagattgcgc atatcaaaca
    5751  agcggtgaag acgaccatga agtcggttga acgccactcc gaaacttttg
    5801  aaggaagcga aatttcttct ggttactcgt catcttcgga tgaaggcgca
    5851  gcggttgacc aagtcactca gacctctcca ggtgcggctg atagcgaaaa
    5901  aacccaattg ctaccaatca tttcagaatt cgcaacaccg cgccgtgaag
    5951  tgaaacactc tgcatctggt agaaaagaag gtttgtgcaa atacctgcag
    6001  agtttaaaca tttgttccag acccccagtt ccgtacacgc aggtggcacc
    6051  tctacccggc aactactcac gttgtactaa tgccgttcgg gagttttact
    6101  tccttcaaga agtgtctctc ttcgacttgc actacaaatt cttgcgttat
    6151  tgggaacagt tgaagtgtat ggacttcgat cgcactcgca ctgaatgcga
    6201  aatggatgaa gacctgtacg tttacacgtc gagcgccatg aattttgcgc
    6251  ccaagaagaa atctcgtgta ccactcgggc ttgctcatca cgagatgatg
    6301  ttcacggaac acggtgtggt tctcaacgac ccgaaatacc gccacaataa
    6351  acttcagcat gaacaattag cttttgtttc cgcaaacgct tttttgcgtg
    6401  gttgcgagta ccattcctct gtggtttttg acaattcgaa tgtttgtata
    6451  atgctttatg aagccccccc aggtggaggg aaaacgactt ctcttataga
    6501  tctttatttt tcatacaccg gtgatttcaa atgcttgatt gtcaccgcca
    6551  ataaaaattc acagatcgac attaaaaata aagtcaacaa gcgcgctgaa
    6601  aaaaggaaag ccaaaagcgg tgaacaagcg tcaaaggcga aaggtagcgg
    6651  aaaagacgtt atgactattg actcttatct catgaactac ttctcttcca
    6701  agtgcgacat tttgtttgtc gacgagtgtt tcatggtgca tgctggtcag
    6751  gttctagcca tcataaatgc ctcgcagtgt cgccggtgta ttctattcgg
    6801  agattcccgc cagatacact ttattcaaag gaacgaaacc tgtagctcct
    6851  tttacggagg attaaactcc tttattcccc cttcggccag agtctatgga
    6901  gaaatctctt ataggtgccc ttgggatgta tgccaatggt tgtcgaaagt
    6951  ttacaagaac gcaattaaat cgaacaacat cgagtccctt ggcaagagtt
    7001  ctgtggccat acgtgaaatc gaaggcctcg attccgttcc catcctttct
    7051  ggggttaaat acgtgacttt tactcagggt gaaaagagtg aactcgagcg
    7101  gtttttgaaa ccgaaattac cgaaagttga agtcaacact gtgcatgaag
    7151  tccagggtga aaccttttct agagtggcct tagttcgcac caagtaccaa
    7201  gaagacaccc cgtttgtcag cgaaaatcat atcatagtcg ctttgtcgcg
    7251  gcatgttgag tcacttcatt actatgtctt gagctctcgc tgcttcgatg
    7301  acaccagtcg cgcgataaaa gaaatgatgg aaatctccga aaaatacaaa
    7351  actcttccga attacttttc gggttctagc attcagatgg aagtcacggg
    7401  tgaacccgtt gataactctt cctgcaaagc tctttccgcc ccgcttcaat
    7451  cgctcaatga ttttttggaa gagatcgttc caggttccac ctccatcaac
    7501  ttcggggatc cgtctgccga aatgtcagtc tctccctttg agtgcgctgt
    7551  cgatggtgtg actatccacg ctggagacaa tggcagccgc ctccacgatc
    7601  acgatccggc tcgggtttag catagtgagg tctcaagcta ttccccaacg
    7651  gaaaccttcg ttacaagaga atctttactc ttacgaatcg agaaattata
    7701  attttttgaa gtgcgatagg ttttctagtc ccgagatttt cgggaaagct
    7751  atggccacgt ctgtgttgcg taaatgttta gatgctcaaa agctcgctga
    7801  agttaaaaaa gaaactatcg ctttttcgca aagtgctcta ttgaagtgga
    7851  tgagtaaaag agacacgagt cagctgaaga gccttcaggc ggagttcggg
    7901  aaacctttgc agctcgatac cgccatacac tattttaaac tcatggttaa
    7951  acgcgacgcg atagttaaac tagactccac ttgcctcaca aaacacccgg
    8001  cggcccaaaa tattatgttt cacgcgaaag ccgttaatgc gctctattcc
    8051  ccgtgtttcg acgagtttaa gaacaggttt atgtcgtgct tattgcctca
    8101  catcgtcttt ttcactgaaa tggataatcg cgcgttcgcc agcgttgctc
    8151  gcggtgtcct tggcagatgt gctcaagaac tgtttgttgg tgaagtcgac
    8201  ttttcgaaat ttgataagtc tcaagatatc ttcattaagg aattcgaaag
    8251  gtgcgtctac tctcaacttg gtttcgatca cgaactttta gatctctgga
    8301  tgcaaggtga atatcaaggg aaagccacca ctctcgatca tcaattgagc
    8351  tttaacgtcg agtgtcaacg tcgttccgga gccgcgaaca catggatcgg
    8401  gaactccgtt gtaactttgg gaattttaag cttgtattac gatctcgcaa
    8451  aaatgcaagg tgtttttatc tcgggtgatg actcacttat cttttcctct
    8501  caaaaacttt cgaatcattc cgaagctatt tgcctagaaa ccggtttcga
    8551  agcaaaattc atgtcaccga gcgttcccta cttctgctcg aagtttttgg
    8601  ttttttgcga acataaattc tttttcgtac ctgaccctta taagttgatc
    8651  gttaaactcg gccaagtgcg ttctgaagtc gaagatgcgg atctattcga
    8701  aattttcaca tcctttaaag atcttactaa agatatgcat gacgaaaggg
    8751  tgttggaata cctggctcgc cttgtcgaag agaaatacga tgttaaatct
    8801  cgctgcgttt tgtctgcctt gcacgctgtg cactgcctcg ggtcaaattt
    8851  ttcctccttt aagaagcttt ttccgaaaca aaaagggtgg ttgacattca
    8901  gtcgtgtttc taaatctctt cttcaaaaga tctctttggg cgttctccag
    8951  caagaaaagt acagcaccgc ttttggtgag aattattttt tatcatatac
    9001  gtcggatgac gcttaactta gtcctccaca aatagtgtat ggattccact
    9051  ttaaagttct tattactgtt tctcttttgc tgggtctgtt taattttttc
    9101  aatcgtcact tttatctgca tttatttagg aatatccacc tttttctatc
    9151  gacttcctga tcctgagtta gcggtaagcg ccaattcctc cttccgagca
    9201  ccggcgtcgg ctcgcgtgta gtgatggtcg agaccacggt ctacagtttt
    9251  gatgctgcta gcggtatcgc gcagacccgt attggggact ttctcaccat
    9301  cttactaaag aacacaaacg ttccttcttc cccaaaccgt acgcgcaggt
    9351  ggtgtgtttg gttgtccctc cacgacaagt tgtatgaagt ggtcttcgaa
    9401  agaggggttt cgtctcactc ggtgtacacc gttgatcggg acatttctcg
    9451  tggcggggac atatatggag aaacccggct cgaagttacc tcctttaata
    9501  ccgcccgctt agacttagtg gttttgaaca gtgtggttcg cgttttcgtt
    9551  agtgtggacg gcaagtcacc cgtcaacttt gaaacatctt tcatccccga
    9601  tcacattggt ttcggttcgg aatcggtttt ttcaggtgtc gaggctcccg
    9651  acgatttgca atgctatgcc acaacatctt attcgtccag ttttaacttt
    9701  aaaccatcgg ccgttgaaaa aattttgttg actcactccc ctccaaactt
    9751  gtcgattttt cccgactccg ctgggagtgt ttctcgttca aacgaacgtt
    9801  ccgaagcgca tcattcacct atcgctatct caatcgacga ggaagatttc
    9851  gacgtttctc attttcatcc aaacgttcat acaaaaagac acgctgaagg
    9901  tgaagaaaaa cagaaaagaa agacggagtt gttcgcgtgc cgtaatttgt
    9951  ggatcatgac catcattact gtctttttat tcattttagt cttagtactt
   10001  gtctcgcgtg cttagcggaa gtcgtgggag tcactctgtt acccaccgaa
   10051  tatttactta gcaatggtgg tctttgggtt agacttcggt acgacttttt
   10101  cgaccatttc tgttttgaaa gaaggagaaa tttatttgcg aaaacaacaa
   10151  aattcaccat acatacccac ctatattttt ctctcggaag agaccgctga
   10201  agtggcttac gggtatgacg ctgaatcctt gatgtacagc agaaaaataa
   10251  aaggtagttt tttccgtgat ctgaaaaggt gggtagggtg caacgagaag
   10301  aattttgaga agtatatgtc actcttgaag cccagttata aagtcgaact
   10351  atcactcttc ggtagctccg atctgaaaac cgtaaagatg cattcattta
   10401  atccagaagg gaactacagt tactctctcc ctgatctcat tgcctccttc
   10451  gtccggtgca tagtgtacga cgccgaactg tgctttaaga ctaaatgcac
   10501  cggtattata tgctctgtac ctgccggtta taacagctgc cagaggagtt
   10551  ttatgcttga gtgcgtcacg cttagcggat acacgtgttt gcacatcatc
   10601  aacgaacctt ccgcagctgc tttttccgct gctcctcgtt tgggcccgaa
   10651  ggataaattc gtacttgtgt acgactttgg gggggggacc ttcgatgttt
   10701  ccggcgtgtc ggtgcgcaac ggcacgtttg gcgtccgatc ttcaggcggt
   10751  gacatgaatc ttggtggtcg tgacgtcgat cgttctttcg tcgagaaact
   10801  ctacggaaaa atcggtggtc taaccccgga ctattctctt gatgtgagcg
   10851  ctctgaaaga aagaatttca tcaattggga acccgatcgt ttaccaactt
   10901  ccggtgggtg gtgagtttcg cagcgttgag gtcgactctt cagacttagc
   10951  ggaagttgct ctacccttat ttcaaagaac gattaagata atgactaaag
   11001  tccacgacga ttattactca tccgtctcat caaacgataa aattccgcgt
   11051  tcaggtaaag agaagaagga aacatccgac gacggctgcg tcctcatcac
   11101  ggtcggtggg agttcttatt tacccggttt gaagggtctt ttgagcgcca
   11151  tcccatacgt gagcagggtc atagaactcc ccgacgcacg atcttccgtg
   11201  gccgccgggt gtgctatgta ttctctgtgt ttagcaaaag actcatcgat
   11251  gctacttata gattgtgcgt cgcatcatct ttcgattcct tcttatcaat
   11301  gtgaatcgat agttttagta cccgccggcg ctcctatccc tttttcaggg
   11351  cggagaacca tttctcttat gaatgcttca gccaccagtt cttataacgc
   11401  cattcttttt gaaggtgatt actcgaaatg ccctatgaac gaaaggatat
   11451  attcctcggc tattcagctt aaagatttag gtatcacagc tgttagaccg
   11501  gtgacccgta gcataaccat tgagttagac gtctccagcg tcggtaccat
   11551  cacctttaaa gtaaaaggtg aaaaaggggc ggaagtgacc atcggaaaag
   11601  acagaatgtt cgacttctcc ggctgccact ccccaacgcg aagtgtcatg
   11651  aatttgttta aaaacgtcgc tgaacgagtt gttttgaact tagtcctgac
   11701  taggactcca gaggcccgca gccgtttatc cctctctgag gtcgataagt
   11751  tgtataacga aaacagggac tatcagctac agattctaaa gagagactac
   11801  ccaaacttca acgatgtcga caccgacgtt tgcaggtcac tcatgggggt
   11851  gtttgttcaa aagattctac ggggttcccg tgtggaaaga ttacctctct
   11901  aacacggctt catctaacgc aacctatgtt ttaaacactt accgatttaa
   11951  cagcggtcat tctatatccg cttccgacgt cgcgaaagcg gggcgaagtt
   12001  ctgcagtgta cgagttctat ctgctcttga aaagtgaaac aatatataag
   12051  tggtgtgaaa cgtgtgggat cgggattcag accgccttct cggactacga
   12101  caccaacgtg aatagtttta gatccaatat gcttatagac gtggacgtaa
   12151  aaactgtggg ttgccgcttt tctctaagcg atttagaggc cgctcttcgc
   12201  ccatcacacc cactagaaat tcgtgataag actttcctcg agcactgttg
   12251  ggtcttgtcg aacagctgtg gtgaaataat agacccattg gatataaaga
   12301  gatttaaaag cataaccttc ggagacgcta atgcgttagg gaaagccgac
   12351  gaaaccttga tgataggtag ctccgtcggc gactatctat ctcattgcct
   12401  cacggtttta gccaggtcga aattacccag ctctgcaggt gaaacaaaaa
   12451  tgaaagatga ctggttagcg cactgcataa cctacttttc agccacggac
   12501  ttgaattatt catccaaaga aaaaattccc ctccttacgg gaataattta
   12551  tgaactgatc gatcagcaca aaatgttctt atcttcgtat gcgaataacg
   12601  taaaaaattt ttcagtgctc ctaggaaaga tcgttccaac cattgaaagc
   12651  atctggacgt ttaagtggct taagaaacca actgaccatc gtctcttgtt
   12701  tgagttttct ctatccgact tgaataaatc cgcttcgcag gtccttagtt
   12751  taaacgacat gactgttgtt ctagagtcca agctaaatct actcgaaaga
   12801  gtgatacacc attccaacat cgactccctt aaagaagtgg tcgacgccat
   12851  tctcaaagat gaaaatcccg acatcgacgg tgaaacgttg tggatatgct
   12901  tccactgcta ctacggtcaa cacagaacgg ccgccgaacg agttcaagct
   12951  agacccgagt actatgaacc cccgttttct ttaaagaaag cagattcgaa
   13001  acttaaaatt tctttcgtgg gtgttgaaaa actttttacg actcttcaag
   13051  gacagaatcc gggcataaac gtaagaaggc aattttgcgg gcgcatctca
   13101  cacgaagcta tcttcgtctt caagaaaatg ggactccgtt ttccaacgat
   13151  agccaccgtc atcattcctc ctgaattggc gtaccttaac ttagactact
   13201  acaagtgggt agacacatcg cagttaaacc cgaagaagag aggtccttgc
   13251  taagctgcat agagaagtcg acgcgtattg tacggctcgc ctcgttagta
   13301  cgagaggagg gaacgcgctg cgacctccga aatataaaat cgtaaacaac
   13351  acacttaaga ccatcacact tcgtgatcca acaccacatc atcgcgatgt
   13401  cgaaagaact tatgatcgtg tcacccgacg gttctctcga gaaagccgac
   13451  gttagcaagt tagctatagc cactcgcgaa agtatgcaag ccgcgttttc
   13501  cgcactcgat ctttctagcg tttcaggtac cagcgattcc tgtttatccg
   13551  atagcgagtt gaccgaagcc gccacaaaag tgaacaccga gttgaagaaa
   13601  attacaaaag gtgaagacat cgacatgcct tcccatttcg ctgctttaat
   13651  agcgagagcc gctacaatag gcactagtct tagtgcggtc taccgtaacc
   13701  agcaaacata ctccatccgc ggaaaaggaa agtacaccgt gaaagatgct
   13751  gaaatttttc cttatataat tgatattacg gcgaagtatg ggaaacccaa
   13801  tggtttgcgc gccttcttcg cttcgttaga gaacgctttt ttagttatag
   13851  cgaaaatgaa acctcagctt ttcgaaagca gggtggctac ccgcaggggc
   13901  actcctaagg aaaaggggta tttagccacc gatttcttat ccggagcttc
   13951  accaatatta gtggatcaag agagagccat cctaaacagc gcgtcgagtt
   14001  acgcgctgga cagagctgcc agtaaaaaga aaaatagcgg tttggtgagt
   14051  ttgtatgact acggtagata cgactgaagt aaagaacact ctgtgttcgt
   14101  taggggtata gacgaagata tagtaagcag aagctatcga atcttcaccg
   14151  catatacaac tttcgtattc taattattaa tcatcaccat gccagaaaac
   14201  gactctaatg actcatctaa taagagtgct ttaacacaaa cgccgtcaaa
   14251  actcagctcc gtgagcattt ccgacaaaag gttactcacg ggagccgtta
   14301  aagacgcggc aaaaataaaa tttttcaccg gtataacggc gaaatacccg
   14351  tcgataaaca ttgctgacac taacactcac ttgggtatgc tactgcacgg
   14401  ttacgccatc aaaactacat ccaaacaggc ttccgaaccc gaaggtgaat
   14451  ttgtcaacta cactctagga gaaaccgaat actctttcac agaaaaggac
   14501  tacctcaata tttttgactc gattcccagg attacaggta ataacgaacc
   14551  cagagttttt tgtcgatctt tcgccactga gtatctcgat ttcttcttga
   14601  aaaattcgag tactcttccc aataacccaa gggctttatc acaaggatta
   14651  cctccagggt accattattt agccgcagac ttccttgacg cttgtgataa
   14701  actcacctta cacgaagccg cagccgcggt gaaggctaag gatcacgcct
   14751  tagctagcaa acaagtggcc gaccagtttg tcgcgaacgt gtacgaaatc
   14801  gggaaacatt gaactcgatg gaaaaattga aaatcctaac ctccagccat
   14851  gtgacaaccc ctaagcgatt tgatcatcgt atcataatcg ctttggaaaa
   14901  cgaaacgaat ttcgacaact acttcgaagc aacgttattt ttaaaacata
   14951  aggaaatcga cgcaggtgcg gaagatctcc cctttacttt ttcttttaaa
   15001  gacgtcgtct tcgtttctcc ttactcacta attcgagcag agggaggact
   15051  tattagcgga attgaaatcg gcaccgatct ccactcgacg gtgatcgcaa
   15101  acatttcaac ttacatggaa gcaaatgtca gacctctacg catcgttaac
   15151  gagattcctt gctgtgaaag tgaagttgtt ttctggtttt caccgcacag
   15201  aaatatcacc tttgaagtgg ggaatggaaa taccaatcct ctcaccaaac
   15251  gctccttcat tctcacacct ggtgggtggt ctaatctcag cttcacggga
   15301  aacattggtc aatgtcttag gttttgcctc accgatgaag gtgtcggaaa
   15351  agagatcata aaaatattca tgtacacttc gacgctctgc acgaagtaga
   15401  atcattgtag aaatcctctt tcttttatag cgagaaacct tctttctctt
   15451  tttctctgca aatcacacga agcccagaag tcatgaagct ttacatctct
   15501  atctacgaat acatcgcttt agtgagcgaa atctctcgac ttctcgacct
   15551  cgtgtcggaa tgtgtgagtg gcgtcacgta cgataagttt aaagagttca
   15601  gatacaggtt cgttcacctc accatgctca tcccctccct taaaagcgat
   15651  ctcaacgact ctcttcggga cgaaggtttc agcatgcaat ccgaaaagaa
   15701  agagcagtta gtgctttttg aaaagacttg ttccgatgtg caaagtaagt
   15751  tgcgccgcat gatagtgcag tcgtactcca tctcttctcc actcgacctc
   15801  gtagtgtttt tctgtaagaa acactatgaa atgcgttgct gcgactactc
   15851  caccataatg cacgataaag tgaagccgtc gtgcgacgcg gtacttcggg
   15901  acatctccaa cacttttggt gtagacgtct cgcctagatc gtttgagaat
   15951  gggggctttc tcactttgaa agatacctcc tttcgccacc tgttcaaaga
   16001  ctgcttcggt gtgggtgaag aggaaatccg acggctcttg aatgaaaggg
   16051  aaacaggcag ctcgcttttc agcgttgaac cctacgttcc gaagtacgtc
   16101  tcggaaggtg ccgaatcgca catctgaacc gcaacaccgt tgaacgcaat
   16151  aacaaatata aataaataac ccttctggtg atgcttacca gaagctagac
   16201  ttaaaccctc gcagagcgag aacggcacaa gggtgcttag tgtgtgtgta
   16251  ggctagtaga gaaaaaacag aaagaaagtc gcctttctgt ttttcactca
   16301  aaacaatagt tttgagttta aataaataat aaagcgccga tctcaacgac
   16351  tctc