Sequence of DPV Eggplant mottled crinkle virus

Eggplant mottled crinkle virus coat protein gene, complete cds.

ACC No: FJ872112

Dated: 2009-04-27 | Length: 1205 | CRC: -522752950

                
ID   FJ872112; SV 1; linear; genomic RNA; STD; VRL; 1205 BP.
XX
AC   FJ872112;
XX
DT   27-APR-2009 (Rel. 100, Created)
DT   27-APR-2009 (Rel. 100, Last updated, Version 1)
XX
DE   Eggplant mottled crinkle virus coat protein gene, complete cds.
XX
KW   .
XX
OS   Eggplant mottled crinkle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-1205
RA   Dombrovsky A., Lachman O., Pearlsman M., Antignus Y.;
RT   "Characterization of a new strain of Eggplant Mottled Crinkle Virus (EMCV)
RT   infecting eggplants in Israel";
RL   Unpublished.
XX
RN   [2]
RP   1-1205
RA   Dombrovsky A., Lachman O., Pearlsman M., Antignus Y.;
RT   ;
RL   Submitted (30-MAR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Pathology, A.R.O, The Volcani Center, P.O. Box 6, Bet-Dagan 50250,
RL   Israel
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .1205
FT                   /organism="Eggplant mottled crinkle virus"
FT                   /host="eggplant"
FT                   /mol_type="genomic RNA"
FT                   /country="Israel"
FT                   /db_xref="taxon:270256"
FT   CDS             1. .1167
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="capsid protein"
FT                   /protein_id="ACP21314.1"
FT                   /translation="MEIVRRNNNNAIAINKKQLASMAATAAAGALSNYVKNNGAMIVQG
FT                   AVNMGKKAYGAVRNRKNKGNSQAMVHVGGMGGAMMAPVAVSRQLVGSKPKFAGRTAGSV
FT                   TVTHREYLTQVNNSSAFTTNGGIVGNLLQLNPLNGTRFSWLPAIASNFDQYVFNSVVLH
FT                   YVPLCGTNEVGRVAMYWDKDSEDPEPVDRVELANFGILKETAPWAEAILRVPTDKTKRY
FT                   CDDSTVVDRKLIDLGQLGISTYGGTGTNPVGDVFVSYSVTLYFPQPTNTLLSTRQLNLT
FT                   GALVASTGPGYINVTRTPTLITVAFRATGTFLLSGAFRDTGVAVLGVTGGIGINSQTTL
FT                   DVVGVATSFLVNCTVSTLPATLTYGSADITSVTANCTRATRANTATLL"
XX
SQ   Sequence 1205 BP; 323 A; 282 C; 310 G; 290 T; 0 other;

fj872112 Length: 1205  27-APR-2009  Type: N  Check: 3699  ..

       1  atggagatcg taagaagaaa caataataat gcaatcgcaa ttaacaagaa
      51  acaactggcc tctatggcgg ctactgccgc cgctggggct ctgagcaatt
     101  atgtgaagaa caatggagca atgatcgtac aaggtgcagt gaatatgggc
     151  aagaaagctt atggagcagt aaggaatcgt aagaataagg gtaattcaca
     201  ggcaatggtg cacgtaggtg gtatgggcgg ggctatgatg gcccctgtgg
     251  cggtatcccg gcaacttgtg ggcagtaagc caaagttcgc aggtagaact
     301  gctggatcag tcacagtcac ccaccgtgag tacttaaccc aggtgaacaa
     351  ctcctctgct tttacaacca atggagggat tgtcgggaat ttgttacaac
     401  tcaacccgct taatggcaca cggttttcgt ggttaccggc catcgcgtcg
     451  aacttcgatc agtacgtctt taacagcgtt gtgttacatt atgtccccct
     501  ctgtggcaca aatgaagtag ggcgtgttgc aatgtactgg gacaaggact
     551  ctgaggatcc tgagcctgtg gatagagtgg aattagctaa cttcggtata
     601  cttaaagaga cggccccatg ggccgaagct attttgaggg tcccaactga
     651  taagacgaaa cgatactgcg atgacagtac agtggttgac aggaagctta
     701  tcgacctcgg acagctcgga atatctacat atggaggaac cggaactaat
     751  cctgtggggg atgtgtttgt gtcgtatagc gttacgcttt acttcccaca
     801  acccacgaat accctactca gcacgcgaca gcttaacctt actggcgctc
     851  tagtagcatc tactgggccc ggatatatta acgtaacacg tacaccaaca
     901  ctcataactg tagcattcag ggctaccgga actttcctac tttcgggagc
     951  tttccgggac actggtgttg ctgttcttgg tgtgacgggg ggcataggaa
    1001  ttaatagcca aaccacactt gatgttgttg gcgtagccac atcatttctt
    1051  gtgaactgta cagtgtccac actacccgcc acactcacat atggatctgc
    1101  tgatataaca tctgttactg cgaattgcac acgggccacg agggccaaca
    1151  ccgcaacatt gctatagtcg cctcggggcc tcttgaacag accagttcat
    1201  ggata