Sequence of DPV Raspberry leaf mottle virus

Raspberry leaf mottle virus CPh gene (partial), CPm gene and CP gene (partial), genomic RNA, SCRI stock isolate

ACC No: FN391551

Dated: 2010-07-17 | Length: 2892 | CRC: 1307395884

                
ID   FN391551; SV 1; linear; genomic RNA; STD; VRL; 2892 BP.
XX
AC   FN391551;
XX
DT   02-NOV-2009 (Rel. 102, Created)
DT   17-JUL-2010 (Rel. 105, Last updated, Version 2)
XX
DE   Raspberry leaf mottle virus CPh gene (partial), CPm gene and CP gene
DE   (partial), genomic RNA, SCRI stock isolate
XX
KW   .
XX
OS   Raspberry leaf mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus; unclassified Closterovirus.
XX
RN   [1]
RP   1-2892
RA   MacFarlane S.A.;
RT   ;
RL   Submitted (01-MAY-2009) to the EMBL/GenBank/DDBJ databases.
RL   MacFarlane S.A., Plant Pathology, SCRI, INvergowrie, Dundee, DD2 5DA,
RL   UNITED KINGDOM.
XX
RN   [2]
RA   McGavin W.J., MacFarlane S.A.;
RT   "Sequence similarities between Raspberry leaf mottle virus, Raspberry leaf
RT   spot virus and the closterovirus Raspberry mottle virus";
RL   Ann. Appl. Biol. 156(3):439-448(2010).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2892
FT                   /organism="Raspberry leaf mottle virus"
FT                   /isolate="SCRI stock isolate"
FT                   /mol_type="genomic RNA"
FT                   /country="United Kingdom:Scotland"
FT                   /isolation_source="leaf"
FT                   /identified_by="S. MacFarlane"
FT                   /db_xref="taxon:326941"
FT   CDS             <1. .1490
FT                   /codon_start=3
FT                   /transl_table=1
FT                   /gene="CPh"
FT                   /product="coat protein homologue"
FT                   /db_xref="GOA:D0R6H4"
FT                   /db_xref="InterPro:IPR004909"
FT                   /db_xref="UniProtKB/TrEMBL:D0R6H4"
FT                   /protein_id="CAY54347.1"
FT                   /translation="NFYGERTYSSYLSRTTNDFRSAKVRPKLPDHTRADGSKVTSEQMW
FT                   AAPQGTMLNELAYLYCSDEIFGWSKRTGVDIKTLLRGIESRTAAPPEMIPADAAKEGCR
FT                   FSLQDVESFLLSGNFHVDTLTVEHSWALSNACGRLVNPNDVKEFKGMVYDPTLNTAKLT
FT                   ALSSEMGDYLGHCMELYKRYVITKSDEVTVRKEVFIWIETILAPYNLSYYGVDSNPLLT
FT                   GIIFDFMFEHSVYPSNYGVNLKNLRIFKDSFLPVILDIWEYEPSEKLADERLIIPASAM
FT                   DFALHIPKLNIYDMSVVIGERLKFLEVVFEGEKLESVTQRVIALLKVSNPDLDEDVLLD
FT                   TLFVYYGIFCTARSRVVPRPSSINTVRGDLKLVDVSQIESFFSELQLSTPDVNVRRSFM
FT                   GHHYRRVLKLYKEIGLKLPPKCDYIVPADYGYLNVDFYKQIGSDVLTEEEMGHLTAIRD
FT                   RVDYKCRNIVSLNSTPAQGSKFSNSRRINRRNFTRKV"
FT   CDS             1567. .2259
FT                   /transl_table=1
FT                   /gene="CPm"
FT                   /product="coat protein minor"
FT                   /db_xref="GOA:D0R6H5"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0R6H5"
FT                   /protein_id="CAY54348.1"
FT                   /translation="MALVPVKVNDSPANPADAAAIITSSRQDPTSFGGILARLNVASIS
FT                   ETQTDRFSDKQLLEVITKLSSFLKETYHTLDKDLIIHITAIVKRAFTLSTSTKVKYSNT
FT                   GCITYSLNDNTEYTLYDKDVFPFITNTFGGVDTPNAIRKFCCSFELCHTALANLKPSLY
FT                   EGKRFTRLGTPKGKAYLGADFLTGTLPSYSEHDRAITLRCSETALTKTPGEDFAIVSLR
FT                   DLGRRSLV"
FT   CDS             2389. .>2892
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:D0R6H6"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:D0R6H6"
FT                   /protein_id="CAY54349.1"
FT                   /translation="MAEFTIADLKEINVADNTTLSEEVEAKITKPLLAKIETANPGFDD
FT                   KGAKLLVGMILYRLALRTTSPNATFNAHDVTTYKVDGKSVKFDDEMVFGYIANHEAIPP
FT                   GIKNPLRAWGRALDQKYLKFIRPLKTTLDFNQRCNKIGLPVGYEYLCADFLTGAGLDNQ
FT                   EAAIL"
XX
SQ   Sequence 2892 BP; 752 A; 675 C; 651 G; 814 T; 0 other;

fn391551 Length: 2892  17-JUL-2010  Type: N  Check: 8713  ..

       1  gaaactttta cggggaacga acgtactcgt cctacctctc caggaccacc
      51  aatgatttcc gatcagccaa agttaggcct aagttacccg accacacccg
     101  cgctgatggg tcgaaggtca cctccgaaca gatgtgggcg gctcctcaag
     151  gtaccatgtt gaacgaatta gcctacttgt actgttccga tgagatcttc
     201  ggatggagta agcgcactgg tgttgacata aagaccctgc ttaggggtat
     251  cgagtctaga acggcggccc ctcctgagat gatcccagct gacgccgcta
     301  aggaaggatg tagattctct cttcaggatg tagaaagctt tctgctatcc
     351  ggaaattttc acgtagacac cctaactgta gaacactctt gggcacttag
     401  caacgcttgc ggaaggttgg taaatcctaa cgatgttaaa gagttcaaag
     451  gtatggttta cgatcctaca ctcaataccg cgaagcttac cgctctgtca
     501  tcagagatgg gtgattacct aggacactgt atggaattgt acaagcgata
     551  cgtcatcact aagtcggacg aggttaccgt taggaaagag gtttttattt
     601  ggattgagac cattctcgct ccttacaatc ttagctatta cggcgtcgac
     651  tcaaatcctc tcctgactgg gatcattttc gatttcatgt tcgagcattc
     701  tgtttatccc tcgaattatg gtgtcaattt gaagaatctc cgcatcttta
     751  aagattcgtt ccttccggtt atactcgaca tttgggagta cgaaccttcg
     801  gagaaactcg ctgacgaaag gttgatcatc ccggcttccg ccatggactt
     851  cgctctccac atacctaaac tcaacatata cgatatgtcg gtagttatag
     901  gtgaaagatt gaaatttctt gaggtggttt ttgaagggga gaaactagaa
     951  tccgtcactc aacgtgtgat cgctttattg aaagtttcta atcctgattt
    1001  ggatgaagat gtgctcctgg atactctctt cgtctattac ggtatctttt
    1051  gcactgctcg aagtagagtg gttccgagac catcctcgat caacactgtc
    1101  agaggagact tgaaactggt ggacgtatca caaatcgaat ctttcttttc
    1151  tgagttacag ctatctactc ccgatgtgaa cgttcgccgg tcgttcatgg
    1201  gtcaccacta caggcgtgtc ttaaagctgt acaaagaaat agggcttaaa
    1251  cttcctccta agtgtgatta catcgtccct gccgactatg ggtatttgaa
    1301  tgttgatttt tacaagcaga taggttcgga cgttttaact gaagaggaaa
    1351  tgggtcattt gacggcgatt cgggacagag tggactacaa gtgtcgtaat
    1401  atagtctctt tgaattccac tcccgctcaa ggttctaaat tttctaattc
    1451  gcgccgaatc aatcgccgca acttcaccag aaaggtttaa tttcgcttgg
    1501  agctctagcg cttgtcttca ctcagtggga caattctcaa ttcgttcacc
    1551  aacttgtatc gcgaccatgg ctctcgtacc cgttaaagtt aacgactcac
    1601  cggcaaatcc ggccgatgcc gctgctataa tcacatcttc tagacaagat
    1651  ccgacgtctt ttggaggtat tctcgcgcgt ttaaatgtcg cttctatctc
    1701  tgaaacccaa actgatcgtt ttagcgacaa acagttgctc gaagtgataa
    1751  ctaaactttc ttcgtttctc aaagaaactt atcacacttt ggacaaagat
    1801  ttgatcatac acataactgc catagtgaaa agagctttca ctctctctac
    1851  cagcaccaag gtgaagtatt ccaacacggg gtgcatcact tactccctta
    1901  atgacaacac agagtacact ctgtatgaca aggacgtgtt tccatttatc
    1951  actaatacat tcggcggggt ggatactcca aatgcgataa ggaagttttg
    2001  ctgttctttc gaactttgtc acacggcgtt ggcgaatctc aaaccctctc
    2051  tatacgaagg taagagattc actcgtttgg gaacccccaa aggtaaggcg
    2101  tacttgggag cagactttct cactggtact ctaccgagct actccgaaca
    2151  tgatagggcc ataacgctcc gatgttcgga aacggcgctt actaagactc
    2201  ccggtgagga tttcgccatc gtgagtctcc gtgatctggg tcgtaggtcg
    2251  ttagtatgaa cacttctctg gctgtcagtc gctctgctat tgactttcca
    2301  ttgggttttc tttttagagg aacaccgaag ctattcgttt cgttcgtttc
    2351  actatttaat aaaggtattc taaactaagt agggagacat ggcggaattc
    2401  acgatcgcag acttgaaaga aattaatgtg gcagataaca ccactctttc
    2451  ggaggaggtg gaggcaaaga ttaccaaacc gctcctcgct aaaatcgaga
    2501  ccgccaatcc cggttttgat gacaaaggcg ccaagttgtt agtagggatg
    2551  atactttaca ggttggcttt gcgtactact tcgcccaacg ccacttttaa
    2601  cgcacatgac gtcaccacct acaaagtaga tggtaagagc gtgaaattcg
    2651  atgatgaaat ggtgttcggt tacattgcta atcacgaggc tatcccaccc
    2701  ggtatcaaga accctctcag ggcttggggt cgcgcgttag atcagaaata
    2751  tctaaaattc attcggccgt tgaagaccac tttggacttc aatcagcgtt
    2801  gcaataagat agggcttcct gtaggttatg agtacctgtg tgccgatttt
    2851  cttaccgggg ctggtttaga caaccaagag gctgccatac tg