Sequence of DPV Beet black scorch virus

Beet black scorch virus, complete genome, isolate Ir-Ha2

ACC No: FN543466

Dated: 2009-11-20 | Length: 3644 | CRC: 1855773533

                
ID   FN543466; SV 1; linear; genomic RNA; STD; VRL; 3644 BP.
XX
AC   FN543466;
XX
DT   20-NOV-2009 (Rel. 102, Created)
DT   20-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Beet black scorch virus, complete genome, isolate Ir-Ha2
XX
KW   complete genome.
XX
OS   Beet black scorch virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3644
RA   Mehrvar M.;
RT   ;
RL   Submitted (19-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Mehrvar M., Phytopathology (FYMY), UCL University, SE/AGRO:BAPA/FYMY, Croix
RL   du sud, 2, bte.03, Louvain-la-Neuve/1348, BELGIUM.
XX
RN   [2]
RA   Mehrvar M., Bragard C.;
RT   "Iranian Beet black scorch virus is more diverse than anywhere else";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3644
FT                   /organism="Beet black scorch virus"
FT                   /isolate="Ir-Ha2"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran:Hamadan, Asad Abad, Lak Lak"
FT                   /isolation_source="Beta vulgaris"
FT                   /collected_by="Mohsen Mehrvar"
FT                   /db_xref="taxon:196375"
FT   CDS             join(36. .644,648. .2210)
FT                   /ribosomal_slippage
FT                   /product="RNA-dependent RNA polymerase, p82"
FT                   /note="ORF2"
FT                   /note="produced by translational readthrough of ORF1"
FT                   /protein_id="CBA34973.1"
FT                   /translation="MDSIPYVILRILNFVLYSIIFPSLLFFINHHTTILWACLCAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFNDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAARVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCNEMEERRAVLGPSYGKGGLLCTSGFTTPTWRGNPE
FT                   GLLVKRGPPLAKPRKLYRFSGFGTHIRYGVHDHSLGNVRRGLVERLFMVETKDGLAPTP
FT                   KPTPGVYAKLSRFHDLVSSNLTSTTRLTYEQFLGFYSGRKLERYQQAVESLAIRPIGVQ
FT                   DAWLSTFVKAEKLNISAKPDPAPRVIQPRSPRYNVEVGRFLRHAEEHLFDAINRVYGGR
FT                   TVFKGLNADQAGMEMQAMWQEFDNPVGIGMDASRFDQHVSKEALEFEHRIWLSMYHGAD
FT                   RKVLSKLLGMQIHNRGLARCPDGEIRYTVEGCRMSGDINTSSGNCYIMCASVHNYCSRL
FT                   GVKRFRLANNGDDCMLVVESKDEARVRQGLIEYYRELGFTMKVEPTVYELEHIEFCQTR
FT                   PVLVDGAYRMVRNLHQGMSKDLHSLHDLGSKKAAEAWVSAVGSGGRVMNDGVPVLKSFF
FT                   KQFPLLSGPKTKSDMSIALQEDWKYKFNRTGCFKDLTPTPQSRYSFWRAFGVLPDEQIA
FT                   LEKGFSRLSFDKLDQDIQEEVSLLQFSGA"
FT   CDS             36. .647
FT                   /product="RNA polymerase, p23"
FT                   /note="ORF1"
FT                   /protein_id="CBA34974.1"
FT                   /translation="MDSIPYVILRILNFVLYSIIFPSLLFFINHHTTILWACLCAYGFY
FT                   RAFRLIFKIKVEVHPATRAVFNDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAARVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCNEMEERRAVLGPSYGK"
FT   CDS             2228. .2419
FT                   /product="7K protein A, p7a"
FT                   /note="ORF3"
FT                   /protein_id="CBA34975.1"
FT                   /translation="MEQQRSEQRRERRVRSRSEDRKSMSDVGQSAVNREADVKKDMGPS
FT                   VSMTVVGENVEFTQHFHF"
FT   CDS             2421. .2618
FT                   /product="7K protein B, p7b"
FT                   /note="ORF4"
FT                   /protein_id="CBA34976.1"
FT                   /translation="MSTIYVVHEKPSGFLVWAFVVAIVCIIGLLSYTPPERLNHSYHEN
FT                   NQKTQYITIGGASTSKVSTN"
FT   CDS             2434. .2577
FT                   /product="5K protein A, p5a"
FT                   /note="ORF5"
FT                   /protein_id="CBA34977.1"
FT                   /translation="MLCMRSLRGFSCGHLLLQLCVSLDSYRTPHLKDLTTLITKTIRRR
FT                   NT"
FT   CDS             2647. .3345
FT                   /product="coat protein, p25"
FT                   /note="ORF6"
FT                   /protein_id="CBA34978.1"
FT                   /translation="MAPKRNKGSRKARMSDETVRAPAAGGVIQRTPGIPPRIRSTTFGT
FT                   RVTNTELLAGINVSAGGAFSVVGAGLFPSNLGWLNGIASNYSKFRWLSIKLIYVPIVPT
FT                   TTAGAMTMALSYDPADATPASFQQVQQMYNSITAPVWAGFDGATVQLLGDRPTTGAVCI
FT                   DVDVNRFGFTWYRYATLAAINALTANDRNLYIPSVCNVATSGGTLATNVGNLMIKYSIE
FT                   LIEPIPAAIN"
FT   CDS             2693. .2977
FT                   /product="10K hypothetical protein, p10"
FT                   /note="ORF7"
FT                   /protein_id="CBA34979.1"
FT                   /translation="MRLYGLQLLEALYNAHPAFLHVLGPPPLVRVLPTLSCLLASMCQL
FT                   VVLSQLLGLDCFPATLVGSMGLLQIIVSLGGSPSSLSMFPLSPQPRLGP"
XX
SQ   Sequence 3644 BP; 896 A; 836 C; 949 G; 963 T; 0 other;

fn543466 Length: 3644  20-NOV-2009  Type: N  Check: 7497  ..

       1  aagaaaccta accagtttct cgttgatcag tgatcatgga ttcaatcccg
      51  tatgtgatcc tgcgcatact gaattttgtc ctttactcca tcatctttcc
     101  ttcacttctc ttcttcatca accaccacac taccatccta tgggcatgtt
     151  tgtgtgccta cggattctac cgcgcgtttc gcctcatctt caagattaag
     201  gtcgaagtgc accctgccac tcgtgctgtc tttaatgata tggtcactcg
     251  ctttcagcgg gagagcatgt tttcacctga cgacgaagtg cctgagggca
     301  tccccatcca cgaggatgtt gaccttgtta gcgaccccac acacaaagat
     351  attaagaggg tccgtgctag caggcgagtc tcatatgctg cgagggtagc
     401  ccatgtagcc aagtcgaagg tgggattact cgccaacact aaggcaaatg
     451  agctggtgta ctctcgattg tgtcgggatg agatggtgac gcacggtgtt
     501  cgtccatcgc acatcgcaca tgcagtgccg ctggctgtcg cggcctgttt
     551  tataccattg gacagtgact ttcttgcagc ttcaattaga aactgcaatg
     601  agatggaaga gcggagggcc gttttagggc cctcgtatgg aaaataggga
     651  ggcctactct gcaccagcgg gtttaccaca ccgacttggc gtggtaatcc
     701  agagggtttg ctggtgaaga gaggacctcc tctggccaaa cctagaaaat
     751  tataccgttt ttctgggttt gggactcata tacggtatgg agtgcatgac
     801  cactccctgg gcaatgttcg gaggggactt gttgagcgtc tgttcatggt
     851  ggaaaccaag gacgggcttg ctccaacacc taagcccacc cctggcgtgt
     901  atgccaagtt atcccggttt catgacctag tcagttccaa tctaacctcg
     951  accaccagat tgacatacga gcagtttctc ggattttatt ctggtcgcaa
    1001  attagaaagg taccagcagg ccgtggagtc gttagcaatc cgcccaatag
    1051  gggtacagga tgcttggctt agcacgttcg tgaaggctga aaaattaaac
    1101  atctcagcta aacccgaccc ggcacctagg gttattcagc ctaggtcgcc
    1151  gaggtacaat gtggaggtcg gacggttcct cagacatgct gaggaacatc
    1201  tgttcgatgc tatcaatcgt gtgtatggtg ggcgtacagt gttcaaaggg
    1251  ttgaacgctg atcaggctgg catggagatg caagccatgt ggcaagaatt
    1301  tgacaatccc gttggtattg gcatggatgc ctcccggttc gaccaacacg
    1351  tctcgaaaga ggcgttggag tttgaacaca ggatatggct atccatgtac
    1401  catggagctg ataggaaggt gctgtcaaag cttttgggaa tgcaaattca
    1451  caatcgcggt cttgccagat gccctgatgg ggaaatcagg tacacggttg
    1501  aagggtgtcg tatgtctggg gatattaaca cttcctctgg taactgttat
    1551  ataatgtgtg catccgtaca caattattgc agtcggttgg gtgttaagcg
    1601  gtttaggctt gccaataatg gtgacgattg catgcttgtg gtcgaatcca
    1651  aggatgaagc acgtgtaagg cagggactca tcgagtatta cagggagcta
    1701  gggttcacca tgaaggtaga acccactgtc tatgaactcg agcatattga
    1751  gttttgccaa acacgtccag tccttgttga tggtgcctac agaatggtac
    1801  gcaatcttca ccagggtatg tccaaggacc tacactcctt gcatgatctt
    1851  ggtagcaaga aggctgctga ggcttgggtt tcagcagtgg ggagcggggg
    1901  tcgcgtgatg aacgatggag taccagtgct caaatcgttt ttcaagcaat
    1951  tccccttgct ctctggacct aaaaccaagt ccgatatgag tatagcgttg
    2001  caggaagatt ggaaatacaa gttcaatcgg actgggtgtt tcaaggattt
    2051  aacacccact ccacaatccc gctactcatt ttggcgtgcg tttggagtgt
    2101  taccagatga acagatagcc ctggagaagg gattttctcg tcttagcttt
    2151  gataagttgg accaggatat ccaggaggag gttagcctcc tccaattctc
    2201  tggggcatga aaacctaacc acttttcatg gaacaacagc gtagtgaaca
    2251  acgtcgtgaa cgtagagtga gaagtagatc ggaggacagg aagtcgatgt
    2301  ctgatgtagg acagtctgct gtgaataggg aagcggatgt caagaaggat
    2351  atgggtccat cggtctctat gacggtggtg ggggaaaacg tggagttcac
    2401  acaacatttc cacttctgaa atgagcacca tttatgttgt gcatgagaag
    2451  ccttcggggt ttctcgtgtg ggcatttgtt gttgcaattg tgtgtatcat
    2501  tggactctta tcgtacaccc cacctgaaag acttaaccac tcttatcacg
    2551  aaaacaatca gaagacgcaa tacataacta ttggaggagc atccactagt
    2601  aaagtttcca cgaactgaat ttactgcttt ctagtatagt taataaatgg
    2651  cacctaagcg taataaaggg agtaggaaag ctcgtatgtc cgatgagact
    2701  gtacgggctc cagctgctgg aggcgttata caacgcacac ccggcattcc
    2751  tccacgtatt aggtccacca cctttggtac gcgtgttacc aacactgagt
    2801  tgcttgctgg catcaatgtg tcagctggtg gtgctttctc agttgttggg
    2851  gctggactgt ttcccagcaa ccttggttgg ctcaatggga ttgcttcaaa
    2901  ttatagtaag tttaggtggc tctccatcaa gcttatctat gttcccattg
    2951  tccccacaac cacggctggg gccatgacta tggctttatc atacgatccc
    3001  gctgatgcta cacccgccag cttccagcag gtgcaacaga tgtataacag
    3051  catcactgca cctgtttggg ctggtttcga tggagctact gttcagctgt
    3101  taggggatcg gccaacgacc ggagctgtgt gtatcgatgt tgatgtcaac
    3151  cggttcggtt tcacatggta taggtatgca acactcgctg ctattaacgc
    3201  actcactgct aatgatagga atctatatat ccctagcgtt tgcaatgtgg
    3251  ctacgagcgg cggaactctt gctaccaatg ttggcaattt aatgataaaa
    3301  tacagtatag agcttatcga gcctataccc gctgccatta attagatccc
    3351  acatcctggt gtggttaatc cagtgaaaaa tattaggaaa tccttgggat
    3401  tcacacccca aggaggattg cttgcatggt gcaggtatgt tgagttacac
    3451  tgtgaggtat cgatgctgga tcctgggaaa caggcttgac aggtttgggt
    3501  ggttccaaac cgctgtatca ctcgagatac tcacggtatt caacaagaaa
    3551  acaccatgcg tgcgcacacg gctggctatg tcctatcata gccgggggct
    3601  ccggagtgcg aaaccctctt atatacctgg tcttccaggt gccc