Sequence of DPV Beet black scorch virus

Beet black scorch virus, complete genome, isolate Ir-Sh1

ACC No: FN543471

Dated: 2009-11-20 | Length: 3644 | CRC: 597429081

                
ID   FN543471; SV 1; linear; genomic RNA; STD; VRL; 3644 BP.
XX
AC   FN543471;
XX
DT   20-NOV-2009 (Rel. 102, Created)
DT   20-NOV-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Beet black scorch virus, complete genome, isolate Ir-Sh1
XX
KW   complete genome.
XX
OS   Beet black scorch virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3644
RA   Mehrvar M.;
RT   ;
RL   Submitted (19-AUG-2009) to the EMBL/GenBank/DDBJ databases.
RL   Mehrvar M., Phytopathology (FYMY), UCL University, SE/AGRO:BAPA/FYMY, Croix
RL   du sud, 2, bte.03, Louvain-la-Neuve/1348, BELGIUM.
XX
RN   [2]
RA   Mehrvar M., Bragard C.;
RT   "Iranian Beet black scorch virus is more diverse than anywhere else";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3644
FT                   /organism="Beet black scorch virus"
FT                   /isolate="Ir-Sh1"
FT                   /mol_type="genomic RNA"
FT                   /country="Iran:Khorasan Shomali, Shirvan"
FT                   /isolation_source="Beta vulgaris"
FT                   /collected_by="Mohsen Mehrvar"
FT                   /db_xref="taxon:196375"
FT   CDS             join(36. .644,648. .2210)
FT                   /ribosomal_slippage
FT                   /product="RNA-dependent RNA polymerase, p82"
FT                   /note="ORF2"
FT                   /note="produced by translational readthrough of ORF1"
FT                   /protein_id="CBA35009.1"
FT                   /translation="MDSIPYVILRILDFIFHSIFFPSLLFIIKHNTTILWACLCAYGFY
FT                   RAFRLVFKIKVEVHPATRAVFKDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCQEMEERRAVLGPSYGKGGLLCTSGFTTPTWRGNPE
FT                   GLLVKRGPPLAKPRKLYRFSGFGTHIRYGVHDHSLGNVRRGLVERLFMVETKDGLAPTP
FT                   KPTPGVYAKLSRFHDLVSANLTSTTRLTYEQFLGFYSGRKLERYQQAVESLAIRPIGVQ
FT                   DAWLSTFVKAEKLNISAKPDPAPRVIQPRSPRYNVEVGRFLRHAEEHLFDAINRVYGGR
FT                   TVFKGLNADQAGMEMQAMWQEFDNPVGIGMDASRFDQHVSKEALEFEHKIWLSMYHGSD
FT                   RKTLAKLLGMQIHNRGLARCPDGEIRYTVEGCRMSGDINTSSGNCYIMCATVHNYCSRL
FT                   GVKRFRLANNGDDCMLVVEAKDEARVRQGLIEYYRELGFTMKVEPTVYELEHLEFCQTR
FT                   PVLVDGAYRMVRNLHQGMSKDLHSLHDLGSRKAAEAWVSAVGSGGRVMNDGVPVLKSFF
FT                   MQFPLSAAPKTKSDMSIALQEDWKYKFNRTGCFRNLAPTPQSRYSFWRAFGVLPDEQIA
FT                   LENGFSRLSFDKLDQDIQEEVSLLQFSGA"
FT   CDS             36. .647
FT                   /product="RNA polymerase, p23"
FT                   /note="ORF1"
FT                   /protein_id="CBA35010.1"
FT                   /translation="MDSIPYVILRILDFIFHSIFFPSLLFIIKHNTTILWACLCAYGFY
FT                   RAFRLVFKIKVEVHPATRAVFKDMVTRFQRESMFSPDDEVPEGIPIHEDVDLVSDPTHK
FT                   DIKRVRASRRVSYAVRVAHVAKSKVGLLANTKANELVYSRLCRDEMVTHGVRPSHIAHA
FT                   VPLAVAACFIPLDSDFLAASIRNCQEMEERRAVLGPSYGK"
FT   CDS             2228. .2419
FT                   /product="7K protein A, p7a"
FT                   /note="ORF3"
FT                   /protein_id="CBA35011.1"
FT                   /translation="MEQQRSEQRRERRVRSRSEDRKSMSDVGQSAVNREADVKKDMGPS
FT                   VSMTVVGENVEFTQHFHF"
FT   CDS             2421. .2618
FT                   /product="7K protein B, p7b"
FT                   /note="ORF4"
FT                   /protein_id="CBA35012.1"
FT                   /translation="MGTVYVVREEPSGFLVWAFVVAIVCIIGLLSYTPPERLNHSYHEN
FT                   NQKTQYITIGGASTSKVSTN"
FT   CDS             2434. .2577
FT                   /product="5K protein A, p5a"
FT                   /note="ORF5"
FT                   /protein_id="CBA35013.1"
FT                   /translation="MLFAKNPQGSSCGHSLLQLCVSLDSYRTPHLKDLTTLITKIIRRR
FT                   NT"
FT   CDS             2647. .3345
FT                   /product="coat protein, p25"
FT                   /note="ORF6"
FT                   /protein_id="CBA35014.1"
FT                   /translation="MAPKRNKGGRKTRMSDETVRAPAAGGVIQRTPGIPPRIRSTTIGT
FT                   RVSNTELLAGVNVAAAGAFSVVGAGLFPSNLGWLNGIASNYSKFRWLSIKLIYIPIVPT
FT                   TTAGAMTMALSYDPADATPTSFQQVQQMYNSITAPVWAGFDGATVQLLGDRPTIGAVCI
FT                   DVDVNRFGFTWYRYATLAAITALTANDRNLYIPSVCNVATSGGSAATNVGNLMIKYSIE
FT                   LIEPIPAAIN"
FT   CDS             3410. .3547
FT                   /product="5K hypothetical protein B, p5b"
FT                   /note="ORF7"
FT                   /protein_id="CBA35015.1"
FT                   /translation="MEDCLHDAGMFSHTVRYRCWILVNRLDRFGWFQTDVSLEIFIVLS
FT                   "
XX
SQ   Sequence 3644 BP; 914 A; 853 C; 935 G; 942 T; 0 other;

fn543471 Length: 3644  20-NOV-2009  Type: N  Check: 2868  ..

       1  aagaaaccta accagtttct cgttgatcag cgatcatgga ttctatcccg
      51  tatgtgatcc tgcgcatact tgattttatc tttcactcca tcttctttcc
     101  atcccttctc tttatcatca aacacaacac caccatccta tgggcttgtc
     151  tatgtgccta tgggttctac cgtgctttcc gccttgtttt caagatcaag
     201  gttgaggtac atccagccac ccgtgctgtc tttaaggaca tggtcacccg
     251  tttccagcgg gagagtatgt tctcgcctga cgatgaagtg cctgagggca
     301  tccctatcca cgaggacgta gaccttgtta gcgaccccac acacaaagat
     351  attaagaggg tccgagctag caggcgagtc tcatacgctg tgagggttgc
     401  tcatgtagcc aagtcaaagg tgggactact tgcaaatacc aaggcaaatg
     451  agctggtgta ttctcggctt tgtcgagatg agatggtcac ccacggtgtg
     501  cgcccatcac acattgcgca tgcagtgccg ctcgctgtcg cggcctgttt
     551  tatcccattg gacagtgatt tcttggcagc atcaattaga aactgccagg
     601  agatggaaga gcggagggcc gttttggggc cctcatatgg aaaataggga
     651  ggcctactct gcaccagcgg gtttaccaca ccaacttggc gtggtaatcc
     701  agagggtttg ctggtgaaga gaggaccacc tctggccaaa cctagaaaac
     751  tgtaccgttt ttctggattt gggactcata tacggtacgg agtgcacgat
     801  cactccttgg gcaatgttcg gaggggactt gtcgagcggc tattcatggt
     851  agagaccaaa gatggccttg ctccgacacc aaagcccacc cctggcgtgt
     901  atgccaagtt atcccggttc catgaccttg ttagtgccaa tctaacctcg
     951  accaccagat taacatacga gcaatttctc gggttttatt ctggtcgcaa
    1001  attggagagg taccaacagg ctgtggagtc gttagcaatc cgccctatag
    1051  gggtccagga tgcttggctt agcacgttcg ttaaggctga aaaactcaac
    1101  atttcagcta aacccgaccc ggcacctagg gtcattcagc ctaggtcgcc
    1151  gcggtacaat gtggaggttg gacggttcct cagacatgct gaggaacatc
    1201  tgttcgatgc cattaaccgt gtgtatggtg gacggacagt attcaagggg
    1251  ttgaatgctg atcaggctgg catggagatg caagccatgt ggcaagagtt
    1301  tgacaatcct gtcggcattg gcatggacgc ctctcggttt gatcaacacg
    1351  tttccaagga ggcgttggag ttcgaacaca agatatggtt gtccatgtac
    1401  catggctctg acaggaaaac attggcaaag ctgttgggga tgcaaatcca
    1451  caatcgcggt cttgctagat gtcctgatgg ggaaatcagg tacacggttg
    1501  aagggtgtcg tatgtctgga gatatcaaca cctcttccgg caactgttat
    1551  ataatgtgtg caactgtgca caattattgc agccggttgg gtgttaagag
    1601  gttcaggctt gccaataatg gtgatgattg catgctagtc gtggaagcta
    1651  aggatgaagc gcgtgtaagg caagggctta ttgaatacta tagggagttg
    1701  ggattcacaa tgaaagtgga acccactgtc tacgaacttg agcatcttga
    1751  gttttgccaa acccgcccag tcctggttga tggggcttac agaatggtgc
    1801  gcaatctaca ccagggcatg tcgaaggacc tacactcctt gcatgatctt
    1851  ggaagtagga aagctgccga ggcatgggtc tcagcagttg gcagtggggg
    1901  acgagtgatg aatgacgggg tgcctgtact taagtcgttc ttcatgcagt
    1951  ttcccctatc tgctgctccc aaaaccaagt ctgatatgag tatagcgttg
    2001  caggaagatt ggaaatacaa attcaatcgg actgggtgtt tcagaaattt
    2051  agcacccact ccacaatccc gctactcatt ttggcgtgca tttggagtgt
    2101  tgccagatga acagattgcc ctggaaaacg gattttctcg tctaagtttt
    2151  gacaaactag accaggatat ccaggaggag gttagccttc tccagttctc
    2201  tggggcatga aaacctaacc aattttcatg gaacaacagc gtagtgaaca
    2251  gcgtcgtgaa cgtagggtga gaagcagatc ggaggacagg aagtctatgt
    2301  ctgatgtggg acagtctgca gttaataggg aagcagacgt caagaaagac
    2351  atgggtccat cggtctctat gacggtggtg ggggagaacg tggagttcac
    2401  acaacatttc cacttctgaa atgggcacag tctatgttgt tcgcgaagaa
    2451  ccctcagggt tcctcgtgtg ggcattcgtt gttgcaattg tgtgtatcat
    2501  tggactccta tcgtacaccc cacctgaaag acttaaccac tcttatcacg
    2551  aaaataatca gaagacgcaa tacataacta ttggaggagc atccactagt
    2601  aaggtttcca cgaactgaat ttactgcttt ctagtataga taataaatgg
    2651  cacctaaacg caacaaagga ggtaggaaga cccgcatgtc cgatgagacg
    2701  gtgcgagctc ctgccgctgg aggtgtgata caacgcacac ccggtatccc
    2751  tccacgtatt aggtccacca ctattggtac gcgagtatcc aacacagaat
    2801  tgcttgctgg tgtcaatgtt gcagcagcag gtgcattttc tgtcgttgga
    2851  gccggtcttt tccccagtaa ccttggttgg ctcaatggga ttgcttccaa
    2901  ctacagcaag tttagatggc tttctataaa gctcatctat attcccattg
    2951  tccctacaac cactgctggc gctatgacca tggctttatc atacgacccg
    3001  gctgatgcta cacctaccag cttccaacaa gtgcaacaaa tgtataacag
    3051  cataactgca cctgtgtggg ctggatttga tggagctact gttcagctat
    3101  taggggatcg cccaacaatt ggtgccgtgt gtatcgatgt tgatgtcaat
    3151  cgatttggat tcacatggta caggtacgca accttagccg ctattacagc
    3201  actcactgca aacgacagga atctatacat tcctagcgtt tgcaatgtgg
    3251  ctacttctgg cggatctgct gcgactaatg ttggcaactt aatgataaag
    3301  tacagcattg agctcattga gcccataccc gctgccatca attagatccc
    3351  acatcctggt gtggttaatc cagtgaaaaa tattaggaaa tccatggaat
    3401  tcacacccca tggaggattg cttgcatgat gcaggtatgt ttagtcacac
    3451  tgtgaggtat cgatgctgga tcctggtaaa caggcttgac aggtttgggt
    3501  ggttccaaac cgatgtatca ctcgagatat tcatagtact aagctagaaa
    3551  acatcatgcg tgcgcacacg gccggctacg tcctatcgtg gccgggggct
    3601  ccggagtgcg aaaccctctt atatacctgg ttttccaggt gccc