Sequence of DPV Citrus tristeza virus

Citrus tristeza virus CP gene for coat protein, genomic RNA, isolate VinhLong1

ACC No: FN811554

Dated: 2010-04-21 | Length: 672 | CRC: -2146540713

                
ID   FN811554; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FN811554;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Citrus tristeza virus CP gene for coat protein, genomic RNA, isolate
DE   VinhLong1
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Dang H.T.;
RT   ;
RL   Submitted (18-APR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Dang H.T., Institute of Biotechnology, Plant Biotechnology, 18 Hoang Quoc
RL   Viet Road, Ha noi, 844, VIET NAM.
XX
RN   [2]
RA   Ngo L.N., Dang H.T., Le S.V., Chu H.H.;
RT   "Cloning and sequence analysis of coat protein genes of Citrus tristeza
RT   virus isolated from Vietnam";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="VinhLong1"
FT                   /mol_type="genomic RNA"
FT                   /country="Viet Nam:Vinh Long"
FT                   /collected_by="Huong Dang Thi"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CBL66726.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDPTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 123 C; 176 G; 182 T; 0 other;

fn811554 Length: 672  21-APR-2010  Type: N  Check: 4118  ..

       1  atggacgacg agacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgcag cggagtcttc tttcggttcc ttaaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaggtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagataagga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcataa cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtattggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttatggt ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga