Sequence of DPV Citrus tristeza virus

Citrus tristeza virus CP gene for coat protein, genomic RNA, isolate CanTho1

ACC No: FN811556

Dated: 2010-04-21 | Length: 672 | CRC: -570801277

                
ID   FN811556; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   FN811556;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Citrus tristeza virus CP gene for coat protein, genomic RNA, isolate
DE   CanTho1
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RA   Dang H.T.;
RT   ;
RL   Submitted (18-APR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Dang H.T., Institute of Biotechnology, Plant Biotechnology, 18 Hoang Quoc
RL   Viet Road, Ha noi, 844, VIET NAM.
XX
RN   [2]
RA   Ngo L.N., Dang H.T., Le S.V., Chu H.H.;
RT   "Cloning and sequence analysis of coat protein genes of Citrus tristeza
RT   virus isolated from Vietnam";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="CanTho1"
FT                   /mol_type="genomic RNA"
FT                   /country="Viet Nam:Can Tho"
FT                   /collected_by="Huong Dang Thi"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /protein_id="CBL66728.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSINLHIDPTLIAMNDV
FT                   RQLSTQQNAALNRDLFLTLKGKYPNLSDKDKDFHLAMMLYRLAVKSSSLQSDDDTTGIA
FT                   YTREGVEVDLSDKLWTDVVFNSKGIGNRTNALRVWGRSNDALYLAFCRQNRNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLIDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFSA
FT                   R"
XX
SQ   Sequence 672 BP; 191 A; 128 C; 175 G; 178 T; 0 other;

fn811556 Length: 672  21-APR-2010  Type: N  Check: 1361  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ataaacttac
     101  acatcgatcc gactctgata gcgatgaacg atgtgcgtca gttaagtacc
     151  caacagaacg ccgctttgaa cagagatttg ttccttactt tgaaagggaa
     201  gtatcctaat ttgtctgata aagacaaaga ctttcactta gctatgatgt
     251  tgtatcgttt agcggttaag agttcatcat tgcaaagtga cgacgacacc
     301  acgggcatag cgtacactcg ggagggcgtc gaagtggatt tgtctgacaa
     351  actttggact gacgtcgtgt ttaattctaa gggtatcggt aaccgtacta
     401  acgcccttcg agtctggggt agaagtaacg atgcccttta tttagcgttt
     451  tgtagacaga atcgcaattt gagttacggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagccg
     551  gcttgattga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggggctga tgaagtcgta gttaccaatg tcaggcagct
     651  tgggaaattt agcgcacgtt ga