Sequence of DPV Citrus tristeza virus

Citrus tristeza virus CPm gene for minor coat protein, genomic RNA, isolate DongThap1

ACC No: FN811558

Dated: 2010-04-21 | Length: 723 | CRC: 1101993356

                
ID   FN811558; SV 1; linear; genomic RNA; STD; VRL; 723 BP.
XX
AC   FN811558;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Citrus tristeza virus CPm gene for minor coat protein, genomic RNA, isolate
DE   DongThap1
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Dang H.T.;
RT   ;
RL   Submitted (18-APR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Dang H.T., Institute of Biotechnology, Plant Biotechnology, 18 Hoang Quoc
RL   Viet Road, Ha noi, 844, VIET NAM.
XX
RN   [2]
RA   Ngo L.N., Dang H.T., Le S.V., Chu H.H.;
RT   "Cloning and sequence analysis of coat protein genes of Citrus tristeza
RT   virus isolated from Vietnam";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="DongThap1"
FT                   /mol_type="genomic RNA"
FT                   /country="Viet Nam:Dong Thap"
FT                   /collected_by="Huong Dang Thi"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .723
FT                   /gene="CPm"
FT                   /product="minor coat protein"
FT                   /protein_id="CBL66730.1"
FT                   /translation="MASYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIEG
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGIILRASESMLARRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 221 A; 133 C; 167 G; 202 T; 0 other;

fn811558 Length: 723  21-APR-2010  Type: N  Check: 8647  ..

       1  atggcgagtt acacgatgct tcccaaaacc gatgacaaag aaatggaccc
      51  ggtgagtgcc gctgtgcccg gtaaataccc ggacgttatc gaaaagtttg
     101  tgaccaatag gtcggtagat gcgttaatag aaggtgttat tagcaagttg
     151  gatactaatt caatatacga agattccact gaaaaattta ctggtgagca
     201  attgaagtac gtcatggtta ctatggacac tttcttacta gaaaattaca
     251  aaacgaaaac ggaagatctg ctggttcact tggctatgat tcaaaagagg
     301  ttgtgcacta tatctacgag tactaaaacc aaatttcgtg ataaaggttg
     351  tatcagttac gtgcaagggg gtttacgata taagttaatg gataaagtag
     401  tttttccttt tattatatct aagtttactg acagggagac tccaaacgct
     451  ctacgtaagt atgcttgtac ttttgaggag ttacacttgt gcatggctag
     501  gctgagaccc gacttatacg aaaacaaaag gacgaccaaa gctgggaccc
     551  cgcatttaaa aggttactta tcagctgact ttcttacggg ttcactcccg
     601  ggatactccg aacatgaacg aggtatcatt cttcgagcgt ctgaatctat
     651  gttagctaga cgtcaaggtt acgaggaggc aaccgagctt cttaacttac
     701  gcgatttggg aaagtatttg tag