Sequence of DPV Citrus tristeza virus

Citrus tristeza virus CPm gene for minor coat protein, genomic RNA, isolate VinhLong1

ACC No: FN811559

Dated: 2010-04-21 | Length: 723 | CRC: 570812279

                
ID   FN811559; SV 1; linear; genomic RNA; STD; VRL; 723 BP.
XX
AC   FN811559;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   21-APR-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Citrus tristeza virus CPm gene for minor coat protein, genomic RNA, isolate
DE   VinhLong1
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-723
RA   Dang H.T.;
RT   ;
RL   Submitted (18-APR-2010) to the EMBL/GenBank/DDBJ databases.
RL   Dang H.T., Institute of Biotechnology, Plant Biotechnology, 18 Hoang Quoc
RL   Viet Road, Ha noi, 844, VIET NAM.
XX
RN   [2]
RA   Ngo L.N., Dang H.T., Le S.V., Chu H.H.;
RT   "Cloning and sequence analysis of coat protein genes of Citrus tristeza
RT   virus isolated from Vietnam";
RL   Unpublished.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .723
FT                   /organism="Citrus tristeza virus"
FT                   /isolate="VinhLong1"
FT                   /mol_type="genomic RNA"
FT                   /country="Viet Nam:Vinh Long"
FT                   /collected_by="Huong Dang Thi"
FT                   /collection_date="2007"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .723
FT                   /gene="CPm"
FT                   /product="minor coat protein"
FT                   /protein_id="CBL66731.1"
FT                   /translation="MAGYTMLPKTDDKEMDPVSAAVPGKYPDVIEKFVTNRSVDALIES
FT                   VISKLDTNSIYEDSTEKFTGEQLKYVMVTMDTFLLENYKTKTEDLLVHLAMIQKRLCTI
FT                   STSTKTKFRDKGCISYVQGGLRYKLMDKVVFPFIISKFTDRETPNALRKYACTFEELHL
FT                   CMARLRPDLYENKRTTKAGTPHLKGYLSADFLTGSLPGYSEHERGITLRASESMLAGRQ
FT                   GYEEATELLNLRDLGKYL"
XX
SQ   Sequence 723 BP; 224 A; 134 C; 165 G; 200 T; 0 other;

fn811559 Length: 723  21-APR-2010  Type: N  Check: 7324  ..

       1  atggcgggtt acacgatgct tcctaaaact gatgacaaag aaatggaccc
      51  ggtgagtgcc gctgtgcccg gtaagtaccc ggacgttatc gaaaaatttg
     101  tgaccaacag gtcagtagat gcgttaatag aaagcgttat tagcaagtta
     151  gatactaatt caatatacga agattccact gaaaaattta ctggtgagca
     201  actgaagtac gtcatggtta ctatggacac tttcttacta gaaaattaca
     251  aaacgaaaac ggaagacctg ctggttcact tggctatgat tcaaaaaagg
     301  ttgtgcacta tatctacgag tactaaaacc aagtttcgtg ataaaggttg
     351  tatcagttat gtacaagggg gtttacgata taagttaatg gataaagtag
     401  tttttccttt tattatatct aagtttactg acagggagac tccaaacgct
     451  ctacgtaagt atgcttgtac ttttgaggag ttacacttgt gcatggctag
     501  gctgagaccc gacttatacg aaaacaaaag gacgaccaaa gctgggactc
     551  cgcatttaaa aggttactta tcagctgact ttcttacggg ttcactccca
     601  ggatactccg aacatgaacg aggtatcact cttcgagcgt cagaatctat
     651  gttagctgga cgtcagggtt acgaggaggc aaccgagctt cttaacttac
     701  gcgatttggg aaagtatttg tag