Sequence of DPV Tolypocladium cylindrosporum virus 1

Tolypocladium cylindrosporum virus 1 CP gene for coat protein and RdRp gene for RNA dependent RNA polymerase, genomic RNA

ACC No: FR750562

Dated: 2011-09-08 | Length: 5196 | CRC: 743372389

                
ID   FR750562; SV 1; linear; genomic RNA; STD; VRL; 5196 BP.
XX
AC   FR750562;
XX
DT   23-DEC-2010 (Rel. 107, Created)
DT   08-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Tolypocladium cylindrosporum virus 1 CP gene for coat protein and RdRp gene
DE   for RNA dependent RNA polymerase, genomic RNA
XX
KW   .
XX
OS   Tolypocladium cylindrosporum virus 1
OC   Viruses; dsRNA viruses; Totiviridae; Victorivirus;
OC   unclassified Victorivirus.
XX
RN   [1]
RP   1-5196
RA   Herrero N.;
RT   ;
RL   Submitted (20-DEC-2010) to the INSDC.
RL   Herrero N., Abiotic Stress, IRNASA-CSIC, C/Cordel de Merinas 40-52, 37008,
RL   SPAIN.
XX
RN   [2]
RA   Herrero N., Zabalgogeazcoa I.;
RT   "Mycoviruses infecting the endophytic and entomopathogenic fungus
RT   Tolypocladium cylindrosporum";
RL   Virus Res. 160(1-2):409-413(2011).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .5196
FT                   /organism="Tolypocladium cylindrosporum virus 1"
FT                   /host="Tolypocladium cylindrosporum"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Castilla y Leon"
FT                   /identified_by="Noemi Herrero"
FT                   /db_xref="taxon:939923"
FT   5'UTR           1. .45
FT   CDS             327. .2603
FT                   /transl_table=1
FT                   /gene="CP"
FT                   /product="coat protein"
FT                   /db_xref="GOA:E7BBP6"
FT                   /db_xref="InterPro:IPR008871"
FT                   /db_xref="UniProtKB/TrEMBL:E7BBP6"
FT                   /protein_id="CBY84991.1"
FT                   /translation="MDFIIRNSFLSGVIASPRGGSLDNDNRFRRYRTSVRTTATIGGND
FT                   DSRTTSIFYEVGRAVNTKGRALNRPSDGALCIEAAYPTNTVLAEDFIGLAKKYTNFSAS
FT                   FEYSSLAGVAERLARALAASSVFTDVDSNDIRGGAGLVVNAVGTYDGPISSLTNTVYIP
FT                   RLVNSSITGEVFSVLANAVSGEGSSVATDIIELDAGTRQPLIPEVDPAGLAAACVDALR
FT                   IVGSNMIASDQGPLFSLAVTRGIHRVLSVVGHTDEGGITRDLLRCSSFAPPFGGIHYAL
FT                   EPYAGLPALQFTAFPAYAAYVDSIALTTAAVVAHADPGVMYGGSWFPTFYNGTADSDGT
FT                   VRPGQNQAGTAAMANRNRAQLLGSAPAFFSEYIRGLATIFGASGDSSLACRFMGAASYA
FT                   LPQDPRHLRYATVSPWFWIEPTGLLPHDFLGSKAEANGAGSFAWKDTTRTRVAWDELTQ
FT                   HGEADTTFSAYVARFRSPRQQWFFAHWMNHPLNGLGAIRVRQLDPNGIVQPGQCVAHPD
FT                   VRDRVEADLPFTDYLWTRGQSPPPAPGELLNLSGSVGFLVRHLTYDDDGVPHEEHVPTR
FT                   REFLDTTVTIEVGRPVGIATGASNAGDNHVRRARTKAANELAAARRRAAVFGRADVAEM
FT                   PILTSAPALAPPPSAGLERGSDPGGSGSQRRAVPAGLPGNDTWAREPTGAPRNPVPHHQ
FT                   PLRAPQLARQAGGLGGGAAPIPPPPPGVPAPPALPPADDDNAPPAPVATAPPVADPQAM
FT                   VGDQI"
FT   CDS             2604. .5126
FT                   /transl_table=1
FT                   /gene="RdRp"
FT                   /product="RNA dependent RNA polymerase"
FT                   /function="dsRNA genome replication"
FT                   /db_xref="GOA:E7BBP7"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="UniProtKB/TrEMBL:E7BBP7"
FT                   /protein_id="CBY84992.1"
FT                   /translation="MVFVSGRVGEFGALGSYLHDLLPELGDVTESYADLELTEQLIKFA
FT                   THSVSLRGVHPLGPVAVSLLCVAYPVQCDFRLSDLTAVLRHSFSFLPQRAPLLELTGLI
FT                   ERRVTLRKAPATIGALHTKVARLCNSDSAARSQLWPPKRHAAAGTKVNIRLAPLAVALS
FT                   RSYGPAWLGRALTPLVGCAEDAVCCALLLATALEPHFGHLGLEVAQSMILEPNNAKGLS
FT                   NALKALGWNSTLPGSMLVEGGALQGRGVSPVDMDAEIASRTTPDLVTDMVISSAAEMAP
FT                   HIRAILALELPSNSGLGDLDEFWSARWLWCVNGAQNRASDRSLNLPSPVRGAKRYRRMA
FT                   AEEVSSNPIYDWDGTTNVSASTKLEPGKSRAIFACDTSSYFAFSWILDRAQRDWRGHRV
FT                   LLNPGEGGLYGVARRVKGAQGRGGVNVMLDYDDFNSHHSLGVQQELTRQLCQLYNAPSW
FT                   YTSVLVDSFDRMYITHRGSRKRILGTLMSGHRGTSFINSVLNAAYIRAAVGGAFFDRLV
FT                   SLHAGDDAYMRCSTLAEAAHVLTRCARFGCRMNPTKQSIGFRHAEFLRLGIGDKYAVGY
FT                   LCRSISTLVAGSWVAPDPLSPEDGLTSAITTVRSCINRGCPSSLSRIIARTYSSIHGYP
FT                   LRVLDALLSGAACLESGAVYNTDYTLRQYRVVRPLPDDLPLPPQHREYATREYLANHVS
FT                   PIEARAAQLASADLVRIMVRSSYSKGVTRHPSSPTSRRRPQLVSLPTVKATGFTTAAEL
FT                   AKRQPPVGKLANFPLLRLIEARLTDDQISELLSFNGTPPGGLPPRIAAFGVEGHCCNVI
FT                   GYLPYSDACSYSKRTTCDNIIAGYSVYS"
FT   3'UTR           3445. .3486
XX
SQ   Sequence 5196 BP; 881 A; 1789 C; 1380 G; 1146 T; 0 other;

fr750562 Length: 5196  08-SEP-2011  Type: N  Check: 3622  ..

       1  tgaaattcac cgcccgcgaa tcaccgattc ccgagcgtac cacgggcccc
      51  ccgcactgcc tcgcgggggg acagcttagt gctgtttccg tggatccgcg
     101  tccttctgtt aggacgacac cggatctggg ccagtgggat cggctgatgt
     151  gcgttcccgt caactaactt tccccccagg gataggccat ccatgctgaa
     201  aaagcgtgcg ccctgaccga taaggtgacg ttgtgtgcgt agaagtaggg
     251  tagggctgcg gcctccgttg atctctacgt atgcaacgtt atagttgacg
     301  gatatactct tctaaccccg cgagccatgg atttcattat tcgcaattct
     351  ttcctttccg gcgttatcgc ctctcctcgc ggtgggagcc tcgataacga
     401  caatcgtttt cgtcgttatc gtacttccgt tcgcacgacc gccaccattg
     451  gcggtaacga tgactcgcgc accacctcta tcttctacga agtggggcgt
     501  gcggtcaaca cgaagggccg cgcccttaac cgcccctccg atggcgccct
     551  gtgcatcgaa gcggcttatc ccacgaatac tgtcctagct gaggatttca
     601  ttggtctggc caagaaatac accaacttct ctgcctcgtt cgagtattca
     651  tcgctcgctg gtgtcgccga gcgtctcgcc cgcgcgcttg ccgcgtccag
     701  cgtcttcacg gacgtcgact cgaacgacat ccgcggcggc gccgggctgg
     751  tcgtcaacgc tgttggtact tacgacggcc ccatctcctc gctcaccaac
     801  acggtctaca tacctcgcct cgtcaactcc tctatcaccg gtgaagtctt
     851  ctcggtcctg gcgaacgctg tatctggtga aggctcctcc gttgcgaccg
     901  acataatcga actcgacgca ggtacccgcc aacccctcat acctgaggtt
     951  gaccccgctg gactcgctgc cgcctgtgtt gacgcccttc gcatcgtcgg
    1001  ttctaatatg attgcaagcg accagggccc gctattctcc ctcgccgtta
    1051  cccgtggtat ccaccgagtc ctttcagtcg ttggccacac cgacgagggt
    1101  ggcatcaccc gcgacttgtt acggtgctcg tctttcgccc cgcctttcgg
    1151  cggcatccac tatgctctcg agccttatgc agggttgccc gccctccaat
    1201  ttaccgcgtt ccccgcctac gccgcctacg tggattccat cgccctaact
    1251  accgccgctg tcgtcgcaca cgctgacccc ggtgtcatgt acggcggctc
    1301  ttggttccca accttctaca atggcactgc cgacagcgat ggcaccgttc
    1351  gccctggcca gaatcaggcc gggacggcag ccatggccaa tcgtaaccgt
    1401  gcccagctct tgggctccgc gccggccttt ttcagtgaat acatccgcgg
    1451  cctcgcaact atctttggtg cgtcgggtga ctcctccctc gcctgccgct
    1501  ttatgggcgc ggcctcttat gctctcccgc aggatccgcg ccatctccga
    1551  tacgctaccg tgtccccctg gttctggata gagccgaccg gtctgctgcc
    1601  gcacgacttc cttggctcta aggccgaggc gaacggcgcg gggtcattcg
    1651  cttggaagga caccacccgt actagggtcg cttgggacga actaacccag
    1701  cacggtgagg ccgacaccac cttcagtgca tacgtcgcca ggttcaggtc
    1751  tcctcgtcag cagtggttct tcgcgcactg gatgaaccat cccctcaacg
    1801  gcctcggcgc tatccgagtc cggcagctcg atcctaacgg gatcgtgcag
    1851  ccaggacagt gcgtcgcgca ccccgacgtc cgtgaccgtg ttgaagccga
    1901  cctacctttc acagactacc tatggacacg cggccaatcg cccccccccg
    1951  cccccggcga gcttctcaac ttgagcgggt ctgttggctt cctcgtccgc
    2001  catctaactt atgatgacga cggcgtcccg catgaagaac atgtcccaac
    2051  gcgccgcgaa tttctcgaca ccacagtgac gatcgaggtg ggtcgtcctg
    2101  tcggcatagc gacgggggct tcgaacgcgg gcgacaacca cgtccggcgt
    2151  gccaggacca aggctgctaa cgaactagct gccgctaggc gtcgtgccgc
    2201  tgtctttggt cgtgccgacg tggctgagat gcccatactg actagcgcgc
    2251  ccgctctagc cccgcccccc agcgccggtc ttgagcgcgg tagtgatcct
    2301  ggcggtagcg gctcccagcg tcgtgccgtc ccggccggtt tgcccggaaa
    2351  cgacacttgg gcgcgggagc ctaccggcgc tcctcgcaat cccgtccccc
    2401  accaccagcc tctccgggct cctcagctcg cgcgtcaagc cggtggtcta
    2451  ggtggcggcg ccgcccctat ccccccccct ccacctggtg tccccgcccc
    2501  gcctgcattg ccccccgctg atgacgataa cgctccgcca gctcctgtgg
    2551  ccactgctcc ccctgttgcc gacccccagg ctatggtggg cgaccagatc
    2601  taaatggtct tcgtctcggg tcgtgtgggt gaatttggtg ccctgggctc
    2651  ctacctacac gacttactcc ccgagttggg tgacgtgact gaatcttatg
    2701  ctgatctcga gttgaccgag cagctgatta agtttgcaac ccactcagtg
    2751  tctctccgcg gtgtacatcc tctcggtcct gttgcggtct cactactatg
    2801  tgtggcctac cccgtccagt gtgatttccg cttgtcggat ctcacggccg
    2851  tcctgcggca ctccttttct tttctcccac aacgtgctcc cctccttgag
    2901  ttaactgggc tcattgagcg gcgcgttacc ctgcgcaagg cccctgccac
    2951  aattggggcc ctacacacta aagtcgcgcg tctttgtaac tccgatagcg
    3001  cggcgcgttc ccagttgtgg ccacccaaac gccacgccgc agctggtacg
    3051  aaggttaata tccgcttagc accccttgcc gtcgccttgt cacgcagcta
    3101  cggtccagcc tggctgggtc gcgcactgac tcctctcgtg ggctgcgcgg
    3151  aagacgcagt ttgctgtgca cttctcctcg cgactgcgct cgagccgcac
    3201  ttcgggcacc tgggactcga ggtggcccag tctatgatcc tcgagccgaa
    3251  caacgctaag ggcctgtcta acgctctcaa ggcccttggc tggaactcca
    3301  ctctccccgg ctcgatgctg gttgagggcg gggcactcca aggccgcggt
    3351  gtatcgcccg ttgacatgga cgccgagatc gcctcgcgta ctacgcctga
    3401  cctcgtcact gacatggtca tatcctcggc tgctgagatg gctcctcaca
    3451  tccgcgctat actggctctc gagcttccca gcaactccgg tttgggagac
    3501  ctcgacgaat tctggtccgc acggtggtta tggtgtgtta acggtgcgca
    3551  aaatcgtgca tccgaccgct ctctcaactt gccctccccc gtgcgcggcg
    3601  cgaaacgtta tcggcgcatg gctgctgagg aggtcagttc gaaccccata
    3651  tacgactggg acggcacgac gaacgtgtct gcctcaacca agttggagcc
    3701  ggggaagtcg cgcgccatct tcgcgtgcga cacctcgtcg tacttcgcct
    3751  tctcgtggat actcgatcgc gcccagcgtg actggcgcgg acaccgtgtc
    3801  ctccttaacc cgggagaggg gggcctctac ggcgtagcac ggcgcgtcaa
    3851  aggtgcccag ggccgtggcg gcgtcaacgt catgctcgac tacgacgact
    3901  tcaattcgca ccactccctc ggcgtccagc aggaactcac tcgccagctc
    3951  tgccaactct acaacgctcc ctcctggtat accagcgtcc tcgtggactc
    4001  cttcgaccgc atgtacatca cccaccgcgg gtctcgtaaa cgcattctcg
    4051  gcacactgat gtccgggcac cgcggcacat cattcatcaa ctccgtgctg
    4101  aacgccgcgt acatacgtgc cgccgtgggt ggtgctttct ttgatcgcct
    4151  cgtctcgctg cacgcgggcg atgacgctta catgcgttgc agcacgcttg
    4201  ccgaggcagc ccacgtccta actcgctgtg cccgtttcgg gtgccgtatg
    4251  aatccgacaa aacagagtat tggtttccgg catgccgagt tcctcaggct
    4301  cggaattggt gacaaatatg ccgtcggtta cctttgccgc tcgatatcta
    4351  ctctggttgc gggatcgtgg gttgccccgg accccctgag ccccgaggac
    4401  ggccttactt ccgcgatcac gacagtccgc agttgtatta accgcgggtg
    4451  tccctcttct ctctcccgta tcatcgcgag gacgtactcg tccatacatg
    4501  gctaccccct ccgtgttttg gatgcattac ttagcggtgc cgcctgcctt
    4551  gaatcaggcg cggtctacaa cacggactat accttacgcc agtatcgtgt
    4601  tgtccggccc ctccccgatg acctcccgct ccctccgcaa cacagggagt
    4651  acgccacccg cgagtacctt gccaatcacg tctcacccat agaggcgcgg
    4701  gcagcacaac ttgcgtcggc agatttggtg cggatcatgg tgcggagcag
    4751  ctactccaag ggagtaacac gtcatccatc atcccccacg tcgcgccgtc
    4801  gtcctcaact tgtgtcttta cccactgtca aggcaactgg tttcaccaca
    4851  gctgctgaac tcgcaaaacg tcaacctccg gtcgggaagc ttgctaactt
    4901  cccgttgctc cggttaatcg aggcccggct cactgacgac cagatcagtg
    4951  agttactatc attcaatggg acccctcctg gtggtctgcc tccccgcata
    5001  gcagccttcg gtgttgaagg ccattgctgt aacgtcatag ggtacctacc
    5051  ctactctgac gcatgctcat acagcaagcg tacgacctgc gataacatta
    5101  tcgccggtta ctcagtctat tcctagacat ggggttcgag caccccccgc
    5151  gcacctttgt gcgccaacga attgggcccg caagggccaa aatgcg