Sequence of DPV Tolypocladium cylindrosporum virus 2

Tolypocladium cylindrosporum virus 2 RdRp gene for RNA dependent RNA polymerase, genomic RNA

ACC No: FR750563

Dated: 2011-09-08 | Length: 3486 | CRC: -633690519

                
ID   FR750563; SV 1; linear; genomic RNA; STD; VRL; 3486 BP.
XX
AC   FR750563;
XX
DT   23-DEC-2010 (Rel. 107, Created)
DT   08-SEP-2011 (Rel. 110, Last updated, Version 2)
XX
DE   Tolypocladium cylindrosporum virus 2 RdRp gene for RNA dependent RNA
DE   polymerase, genomic RNA
XX
KW   .
XX
OS   Tolypocladium cylindrosporum virus 2
OC   Viruses; dsRNA viruses; Totiviridae; Victorivirus;
OC   unclassified Victorivirus.
XX
RN   [1]
RP   1-3486
RA   Herrero N.;
RT   ;
RL   Submitted (20-DEC-2010) to the INSDC.
RL   Herrero N., Abiotic Stress, IRNASA-CSIC, C/Cordel de Merinas 40-52, 37008,
RL   SPAIN.
XX
RN   [2]
RA   Herrero N., Zabalgogeazcoa I.;
RT   "Mycoviruses infecting the endophytic and entomopathogenic fungus
RT   Tolypocladium cylindrosporum";
RL   Virus Res. 160(1-2):409-413(2011).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3486
FT                   /organism="Tolypocladium cylindrosporum virus 2"
FT                   /host="Tolypocladium cylindrosporum"
FT                   /mol_type="genomic RNA"
FT                   /country="Spain:Castilla y Leon"
FT                   /identified_by="Noemi Herrero"
FT                   /db_xref="taxon:939924"
FT   5'UTR           1. .45
FT   CDS             46. .3444
FT                   /transl_table=1
FT                   /gene="RdRp"
FT                   /product="RNA dependent RNA polymerase"
FT                   /function="dsRNA genome replication"
FT                   /db_xref="GOA:E7BBP8"
FT                   /db_xref="InterPro:IPR001795"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:E7BBP8"
FT                   /protein_id="CBY84993.1"
FT                   /translation="MAIKFSTASAFSEQKATMGASYIGEPSGAGTLLMPNERERIGVGK
FT                   LHMHAVVLPVLCGKSLMCHKFSGYDIDDIVVNEEAFKCDQEWEEMIDARERGYFGGDNS
FT                   GYLTSNRIMLRRARRFFDLFVGDGNAPVLYVQTAEMAEALGAEIIYVGSVARGVAAATP
FT                   RYQALSDEEQRLMLKLLIEQDNANEVYCARHGLQYDGISNGYEVQAQRVSERLRRCGLN
FT                   ALTSASQDALDRLYLETSFRGRLNQSCAIACNAELTGWVRAVAAREAQVLVGAALPQGA
FT                   GQVHNHVRWARVIHALEQHALAVVPGPKPVRTRWSEKFPYGPGNAKFALAKIGDFLESV
FT                   SERDYQNGYAWFRQLLNRDDCSYERALCHLIMGDVWCYVAPELKPLVESLRIGGLAPLV
FT                   FAEVCKGIHTLVRDTKSMLGAALNTHGLALCTYFDCLAGRYFGEGDIEKEIHDRTVSLE
FT                   PRHFIMPDGSKSEAEFDMRFKNAVADVLHSTLVDGGARILRASKITKSFDTFLEHRKAW
FT                   VRPGSVTGSPKTDVYIKVVGDREMGIREVADDLHMMGTYVLSRVRLNKAATFEFEKFPE
FT                   LVRDCIGDYVPNSFTRHFIKNEIAKVKGRALFPSHVVHYIVGTYVLQLLMKAAPIEHAR
FT                   LIPDEATPRDEHWMWMEARDFTVGLMLDYDDFNESHEIRDMQMIINSLKGVYRRAGALS
FT                   PDLSAMIDWVVEAYEKMVFEFDGKQYHFLHGMLSGQAPTSMINTVINTANKRVIREQIF
FT                   ALFGESVMTKRTSGGDDVAAETYDVFQAAMIVKVGEMMGFAFSTHKQLISTSDYEFFRL
FT                   FVSAEGVYGSLPRVLGSLCSGQWSNSVKAKFIDPASKLNSVVEMARKAARRAKGNITFL
FT                   EKLCNAAFRKWATFGEHELVDGYVHGPRNKGGLGVPMADGSIYDIEPIPVDDTPPVELL
FT                   GLPDSASRVVAKEQISDAKGIVGESGVVAEDQLAQKMAGQVFRGNIAAMEGAMVGQILS
FT                   DARVPPTVVNITGVKSIRREHYDRHGHDVHVFRRDYARLKHRTDALKNAGARYDALAAA
FT                   VKPGYRRRLAHVVGLTYAVDGDLLYYWKENLTLFGCGTYLLTEDYYNAVQLMALVTAPG
FT                   YSDNEISERLAYYATALANSNMMNY"
FT   3'UTR           3445. .3486
XX
SQ   Sequence 3486 BP; 906 A; 728 C; 1032 G; 820 T; 0 other;

fr750563 Length: 3486  08-SEP-2011  Type: N  Check: 3732  ..

       1  cgcaaaaaag agataaaggt atcaattttt tgcacactac cagaaatggc
      51  tattaaattt tctacggcta gcgcgttctc agaacagaaa gcaacaatgg
     101  gtgcatcgta cattggtgag ccgtcaggcg caggcacact attgatgcca
     151  aatgagcgag aaaggatcgg ggtcggcaaa cttcacatgc atgcagttgt
     201  gctgccagtg ttatgcggaa agagtctgat gtgccacaag ttcagtggat
     251  atgacattga cgacatcgtg gtgaatgagg aagcattcaa gtgcgatcaa
     301  gagtgggaag agatgattga cgcacgggaa cggggctatt tcggtggcga
     351  taactccggc tacctcacat caaatcgcat aatgctacgg cgggcgcgta
     401  ggtttttcga cttgtttgtg ggggatggca acgcgcctgt gttatacgtg
     451  caaacagccg agatggcaga ggcacttgga gcagagatca tctatgtggg
     501  tagtgttgct cgtggagtgg ccgcggcgac gccacgttat caggcactgt
     551  ctgacgagga gcaacgtttg atgctgaagc ttctgataga gcaggacaat
     601  gctaatgagg tgtattgcgc acgacacgga ctacagtatg acggcatatc
     651  taacggttac gaggtacagg cacaacgtgt atcggaacgg ttgcgtcgct
     701  gcggtttgaa cgcattgacg tcagcatcgc aagacgcgct tgacaggcta
     751  taccttgaga cttcttttcg tgggcggctg aatcaatcat gtgcgattgc
     801  atgtaacgca gagttaactg ggtgggtcag ggctgtggcc gcccgtgagg
     851  cgcaagtgct tgtcggcgct gcgttaccac aaggtgcggg ccaagtgcat
     901  aatcatgtgc gatgggctcg agtgatacac gctctggaac agcatgcact
     951  agcagttgtt ccgggcccta agcctgtgcg caccagatgg agcgagaagt
    1001  ttccatacgg accagggaat gctaaattcg ctctcgccaa gataggtgac
    1051  tttctcgaat ccgtatcgga gagggattat caaaatgggt acgcgtggtt
    1101  ccggcaacta ctgaaccgtg atgattgctc gtatgaacgc gcattgtgcc
    1151  acttgattat gggtgatgtt tggtgctatg tcgcccccga gttgaaaccg
    1201  ctcgtggaaa gtctcagaat aggcggctta gctccattgg tgttcgctga
    1251  ggtgtgtaaa gggattcaca cattggtccg cgacactaag tcgatgctcg
    1301  gtgcggctct aaacactcat ggactagcgc tgtgtacgta cttcgattgt
    1351  ctcgctggcc gctacttcgg tgaaggcgat atagagaagg agatacatga
    1401  ccgtacggtg tcgcttgagc ctcggcactt tataatgcct gatggcagca
    1451  aatccgaggc tgagtttgac atgcggttca agaatgctgt agctgatgtg
    1501  ttgcactcca cactagttga cggtggtgct cgcatattac gagccagcaa
    1551  aataacaaag agctttgaca cgttcttgga gcaccgtaaa gcgtgggtga
    1601  ggcctgggtc tgtaactggc agcccgaaaa ctgatgtgta tatcaaggtg
    1651  gtcggtgata gagagatggg gatacgcgag gttgcggatg atctgcatat
    1701  gatgggtacg tatgtgctat ctagagttag acttaacaag gctgctacct
    1751  ttgagtttga gaagtttccg gaactggtgc gcgattgcat aggtgattac
    1801  gtgcccaata gcttcacacg acacttcata aagaacgaga ttgcgaaagt
    1851  gaagggtcga gcattgttcc cgtctcacgt tgtgcactac atcgttggga
    1901  catatgtgct ccaactactc atgaaggcag cgcctattga acacgcacga
    1951  ctgataccgg atgaggcaac accgagagac gagcactgga tgtggatgga
    2001  agcgcgtgac ttcaccgtag ggctgatgct cgattacgac gacttcaacg
    2051  aaagccacga aattcgcgac atgcagatga ttattaattc gcttaagggc
    2101  gtttaccgca gggcgggtgc tttaagcccc gatctgtcgg ctatgataga
    2151  ttgggtggtg gaagcgtacg aaaagatggt gtttgaattc gacgggaagc
    2201  agtaccactt cctgcatggc atgctgtcag ggcaagcacc tacgtcaatg
    2251  ataaacacag tcatcaacac cgcaaacaaa agggttatcc gcgagcaaat
    2301  atttgcgcta tttggtgaga gcgtgatgac aaaaaggact tcagggggcg
    2351  acgatgttgc tgcggagaca tatgatgttt tccaggcagc gatgatagtg
    2401  aaagtcgggg agatgatggg cttcgcgttc agcacacaca agcagttgat
    2451  aagcacgagt gattacgagt tcttccggtt atttgtctct gcggagggcg
    2501  tttatggcag cttaccgcgt gtattaggca gtttatgttc agggcaatgg
    2551  tcgaacagcg tgaaggctaa gtttatagat ccagcttcta aactaaattc
    2601  cgttgttgag atggctagga aggcggctcg ccgggcgaaa ggcaatatca
    2651  cgttccttga gaagttgtgc aatgcagcat ttagaaaatg ggccactttc
    2701  ggcgagcatg agcttgttga cggttacgta catggcccac ggaataaggg
    2751  aggattagga gtaccgatgg ctgacgggag tatatacgat atagagccaa
    2801  taccagtgga tgatacgcct ccggtggagt tattgggctt accggactca
    2851  gcgagccgag tagtggcaaa agagcaaata agcgacgcta aaggtatagt
    2901  cggtgaatcg ggtgtggtgg cagaggatca attggcacaa aagatggcag
    2951  ggcaggtgtt ccgtggcaat atagctgcga tggaaggtgc aatggttggc
    3001  caaatattaa gcgatgcgcg agtgccgcct actgtagtga acatcacggg
    3051  tgtaaaatca ataagacgcg agcattacga taggcatggg catgatgtgc
    3101  acgtgttcag gcgagattac gctcggttaa agcacaggac cgacgcgctt
    3151  aaaaacgctg gcgcacgata cgacgcattg gcagcagcgg tgaagcctgg
    3201  ttacagaaga cgattggcac atgttgtagg cctcacatat gcggttgatg
    3251  gtgatctact atactactgg aaggagaatt taactctttt cggctgcggc
    3301  acatacttac taacggaaga ttactacaac gctgtgcagt tgatggcttt
    3351  agtgacggca ccaggctaca gtgacaatga gataagcgag cgattagcat
    3401  actacgcgac tgcgcttgct aacagcaata tgatgaatta ctagagcgtc
    3451  atagtgcgaa gacaggaatt caaaagaatt tctacc