Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus isolate EghTBSV RNA-dependent RNA polymerase gene, partial cds; and 33 kDa protein gene, complete cds.

ACC No: GQ206144

Dated: 2009-07-28 | Length: 2460 | CRC: 776832695

                
ID   GQ206144; SV 1; linear; genomic RNA; STD; VRL; 2460 BP.
XX
AC   GQ206144;
XX
DT   28-JUL-2009 (Rel. 101, Created)
DT   28-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Tomato bushy stunt virus isolate EghTBSV RNA-dependent RNA polymerase gene,
DE   partial cds; and 33 kDa protein gene, complete cds.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-2460
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   "Molecular Characterization of Egyptian Isolate Tomato Bushy Stunt Virus
RT   (TBSV) and the Disclosure of Defense Genes Against the Virus";
RL   Unpublished.
XX
RN   [2]
RP   1-2460
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   ;
RL   Submitted (04-APR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Pathology, Arid Land Institute (ARADI), Mubarak City for
RL   Scientific Research and Technology Application, Alexandria 21934, Egypt
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .2460
FT                   /organism="Tomato bushy stunt virus"
FT                   /host="Lycopersicon esculentum"
FT                   /isolate="EghTBSV"
FT                   /mol_type="genomic RNA"
FT                   /country="Egypt"
FT                   /db_xref="taxon:12145"
FT   CDS             167. .>2460
FT                   /codon_start=1
FT                   /transl_except=(pos:1055. .1057,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="92 kDa protein; readthrough stop codon"
FT                   /protein_id="ACT67403.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIDCDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAAIPIIPLLSYATWV
FT                   RAVSVRAFGNELSFNVRVPRPSVPKKGLLLRLAAGLAFRPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLITGSRLTKVIASTGTPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRAGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARAPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYDGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYSADEVGAIFREK
FT                   WDRFDKPVAIGLDAWRFDQHCSVEALQYEHSFYRAMYPGNKLLGKLLEWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQRTLPEYFLNLGYTMKVERPVFQLEEVEFDQAHPVQFQGGWKMVGNVRTAMRK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALRAGIPVVETFYSRFKLYDTPRKHQRIDTVTN
FT                   VHKWRGSGGSYV"
FT   CDS             167. .1057
FT                   /codon_start=1
FT                   /product="33 kDa protein"
FT                   /protein_id="ACT67404.1"
FT                   /translation="METIKRMIWPKKEIFVGDFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIDCDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVIPLSIAAIPIIPLLSYATWV
FT                   RAVSVRAFGNELSFNVRVPRPSVPKKGLLLRLAAGLAFRPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLITGSRLTKVIASTGTPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
XX
SQ   Sequence 2460 BP; 639 A; 478 C; 693 G; 650 T; 0 other;

gq206144 Length: 2460  28-JUL-2009  Type: N  Check: 5985  ..

       1  agaaattccc caggatttct cgacctagta cgtctacctg gtgacttgcg
      51  ctgtctgttg ctttgcgtag ggaatttctc tccaatatta ttatctttaa
     101  tttggggttt gaaggttggg tctacccttc ggggggataa attgtaactt
     151  ccaacaaata agcgacatgg agaccattaa gaggatgatc tggcctaaga
     201  aagagatttt tgtgggtgat ttcgcgatcg gagttaatag gacggcaccg
     251  gtggacattt tccaattggt gtgtcgtgtg gttctaagat acatgaggac
     301  agggaaaata gactgtgatt ctgacagcat gactaagttt atagttgaat
     351  tacttaaaac tgattgtgct gccaaatggg agtggtttat gaagagacgg
     401  cagaggggcg actatgttat ccctctatct atagccgcca tcccaatcat
     451  accgctgttg agttatgcca catgggtacg cgcagtctca gtcagggcct
     501  ttgggaatga actttcgttc aatgtcagag tacctagacc atctgtacct
     551  aagaaaggat tgctcctcag actggcggca ggcctagcgt tcagacctat
     601  atgcgcgctg gcagtgtacg ctaccctacc tagggaaaaa ctgtcggtat
     651  ttaagctgag aaccgaggca cgcgcacata tggaggatga gagagaagcg
     701  acagattgct tggtggttga gccggcacgg gaactcaagg gtaaggatgg
     751  tgaggatctc atcactggta gtagattaac taaggtgatt gcgtccacag
     801  ggacgcctcg caggaggccg tatgcagcca agatcgcaca ggttgcgaga
     851  gctaaggtgg gttaccttaa gaatagtcct gagaatagac taatctacca
     901  gcgagtgatg attgagatca tggacaaaga ctgcgtcagg tatgttgaca
     951  gggatgtcat attgccattg gctattggat gctgttttgt ctatccggat
    1001  ggagtggagg agtcggcggc actatggggt tcccaggaat cccttggtgt
    1051  caaataggga ggcctagtac gtctacctgg tgttgtaaca cagatcaatc
    1101  gagatatccc atctgatgtg ttacttcccc aggaggtgct agaggttcgt
    1151  gcaggacctc ccaatgctaa ggaccgtaat atatttatgg ttgcaggttg
    1201  cccatcacag gcacggttct tagtacataa tcactgcctg aaaaacctta
    1251  aaaggggtct tgtggagaga gtcttctgcg tagagagaaa cgggaagctc
    1301  gctcgcgctc cacaacctac caaaggagct tttggacgtc tttccccgtt
    1351  caggaaagcg gtttgtgaga aggttggggt agcccaccga cttgggtatg
    1401  atgggtttct gtcatactac gacggtgcga aactccgtac ttacacacga
    1451  gccgtggaga gtctgcatat cacacctgtt tccgagaggg atagtcattt
    1501  gactaccttc gtgaaagcag agaagatatc gacgtctaaa ggtgacccag
    1551  cacctcgggt gattcagcct cgaaacccga ggtacaatgt ggaacttgga
    1601  agatatctac ggcatatgga atccaagctg atgaaagctg ttgatggcgt
    1651  gttcggagaa acaacatgca tcaaaggata ctctgccgac gaggtgggtg
    1701  caatttttcg ggagaaatgg gataggtttg ataaacctgt agccataggt
    1751  ctcgatgcat ggaggtttga tcaacactgt tccgtggagg ctttgcaata
    1801  tgagcatagt ttctacaggg ccatgtaccc tggcaacaag cttttgggca
    1851  agttgttgga atggcaactc cataataaag gtaaaggtta tgtccctgat
    1901  gggactataa cttatcgtaa ggagggttgt cgtatgagtg gggatataaa
    1951  cacttcgttg gggaactatc tgttgatgtg tgcaatggta catgggtaca
    2001  tgcgtcattt ggggattaat gaatttagtc tggcgaactg tggggatgat
    2051  tgcgttctca ttcttgagcg caggaatctt aaacaggtgc agagaactct
    2101  gcctgagtat ttccttaatt tgggttatac catgaaggtt gagcgacctg
    2151  tatttcaatt ggaagaggtt gaatttgacc aggcacaccc agtacagttt
    2201  caagggggtt ggaagatggt gggaaatgtc cgtactgcta tgagaaaaga
    2251  cgtgcactgt gtcaataata tacgcgattt ggcgacgagg agagcttgga
    2301  gtaatgctca acatcatgga gggctagcac ttagggctgg tatacctgtg
    2351  gttgagactt tttactccag gttcaagctg tatgatacac ctcgtaagca
    2401  tcaacgcatt gacacagtca ctaatgttca taagtggcgt ggatcgggtg
    2451  ggagctatgt