Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus isolate EghP19 19 kDa protein gene, complete cds.

ACC No: GQ206145

Dated: 2009-07-28 | Length: 847 | CRC: -1486409900

                
ID   GQ206145; SV 1; linear; genomic RNA; STD; VRL; 847 BP.
XX
AC   GQ206145;
XX
DT   28-JUL-2009 (Rel. 101, Created)
DT   28-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Tomato bushy stunt virus isolate EghP19 19 kDa protein gene, complete cds.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-847
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   "Molecular Characterization of Egyptian Isolate Tomato Bushy Stunt Virus
RT   (TBSV) and the Disclosure of Defense Genes Against the Virus";
RL   Unpublished.
XX
RN   [2]
RP   1-847
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   ;
RL   Submitted (04-APR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Pathology, Arid Land Institute (ARADI), Mubarak City for
RL   Scientific Research and Technology Application, Alexandria 21934, Egypt
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .847
FT                   /organism="Tomato bushy stunt virus"
FT                   /host="Lycopersicon esculentum"
FT                   /isolate="EghP19"
FT                   /mol_type="genomic RNA"
FT                   /country="Egypt"
FT                   /db_xref="taxon:12145"
FT   CDS             1. .519
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /note="P19"
FT                   /protein_id="ACT67405.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRCDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   FDQIGCTYSIRFRGVSITVSGGSRTLQHLCEMAIRSKQGLLQLAPIEVESNESRGCPEG
FT                   AQTFEKEGE"
XX
SQ   Sequence 847 BP; 223 A; 169 C; 245 G; 210 T; 0 other;

gq206145 Length: 847  28-JUL-2009  Type: N  Check: 3767  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttgggat ggaggatcag gaggtaccac ttctcccttc aaacttcctg
     101  acgaaagtcc gagttggact gagtggcggc tacataacga tgagacgaat
     151  tcgaatcaag ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatgcga caggacggaa gcttcactgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtttcgacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt atcaccgttt ctggagggtc gcgaactctt cagcatctct
     401  gtgagatggc aattcggtct aagcagggac tgctacagct tgccccaatc
     451  gaagtggaaa gtaatgaatc aagaggatgc cctgaaggtg ctcaaacctt
     501  cgaaaaagaa ggcgagtaag acagactctt cagtctgagt ttgtggagat
     551  gagtgtaaat ctggcatagc atacaggtta ctcttgttgg gttctggatg
     601  ttaggatgac gagtcgactc gggctccgca ctaggtttgg tcgcctaggg
     651  gatggagata tggaaagggt ctcgtgtggt atcagtcggt cgaaagacgc
     701  gcatccaaca tgggcctatg gtcggataag tcttagcaat accagccagc
     751  atgaattgga ttcctgttta cgaaagttag gtgtcacttg tggaagcgga
     801  cccagacacg gttgatctca cccttcgggg gggctataga gatcgct