Sequence of DPV Tomato bushy stunt virus

Tomato bushy stunt virus isolate Egh2P19 19 kDa protein gene, complete cds.

ACC No: GQ206146

Dated: 2009-07-28 | Length: 845 | CRC: -908895258

                
ID   GQ206146; SV 1; linear; genomic RNA; STD; VRL; 845 BP.
XX
AC   GQ206146;
XX
DT   28-JUL-2009 (Rel. 101, Created)
DT   28-JUL-2009 (Rel. 101, Last updated, Version 1)
XX
DE   Tomato bushy stunt virus isolate Egh2P19 19 kDa protein gene, complete cds.
XX
KW   .
XX
OS   Tomato bushy stunt virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-845
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   "Molecular Characterization of Egyptian Isolate Tomato Bushy Stunt Virus
RT   (TBSV) and the Disclosure of Defense Genes Against the Virus";
RL   Unpublished.
XX
RN   [2]
RP   1-845
RA   Fattouh F.A., Hafez E.E., Saber G.A., Salah A.;
RT   ;
RL   Submitted (04-APR-2009) to the EMBL/GenBank/DDBJ databases.
RL   Plant Molecular Pathology, Arid Land Institute (ARADI), Mubarak City for
RL   Scientific Research and Technology Application, Alexandria 21934, Egypt
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .845
FT                   /organism="Tomato bushy stunt virus"
FT                   /host="Lycopersicon esculentum"
FT                   /isolate="Egh2P19"
FT                   /mol_type="genomic RNA"
FT                   /country="Egypt"
FT                   /db_xref="taxon:12145"
FT   CDS             1. .519
FT                   /codon_start=1
FT                   /product="19 kDa protein"
FT                   /note="P19"
FT                   /protein_id="ACT67406.1"
FT                   /translation="MERAIQGNDAREQANSERWDGGSGSSTSPFQLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTEASLHRVLGSWTGDSVNYAASRFFG
FT                   VNQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   VETFEEESE"
XX
SQ   Sequence 845 BP; 229 A; 165 C; 239 G; 212 T; 0 other;

gq206146 Length: 845  28-JUL-2009  Type: N  Check: 3703  ..

       1  atggaacgag ctatacaagg aaacgacgct agggaacaag ctaacagtga
      51  acgttgggat ggaggatcag gaagttccac ttctcccttc caacttcctg
     101  acgaaagtcc gagttggact gagtggcggc tacataacga tgagacgaat
     151  tcgaatcaag ataatcccct tggtttcaag gaaagctggg gtttcgggaa
     201  agttgtattt aagagatatc tcagatacga caggacggaa gcttcattgc
     251  acagagtcct tggatcttgg acgggagatt cggttaacta tgcagcatct
     301  cgatttttcg gtgtcaacca gatcggatgt acctatagta ttcggtttcg
     351  aggagttagt gtcaccattt ctggagggtc gagaactctt cagcatctct
     401  gtgagatggc aattcggtct aagcaagaac tgctacagct taccccagtc
     451  gaagtggaaa gtaatgtatc aagaggatgc cctgaaggtg ttgaaacctt
     501  cgaagaagaa agcgagtaag acagactctt cagtctgagt ttgcggaaac
     551  gagtgtaaat ctggcatagc atacaggtta ctcttgttgg gttctagatg
     601  ttatgatgac gagtcggtcg ggctccgcgc taggtttggt cgcctagggg
     651  atggagatat ggaaagggtc tcgtgtgctg tcagtcggtc gaaagacgcg
     701  cttgcaacat gggcctataa ccggataagt catagcaata ctagccaaca
     751  tgaattggat tcctgtttac gaaagttagg tgacacttgt ggaaacggac
     801  ctggacacgg ttgatctcac cttcgggggg gctatagaga tcgct