Sequence of DPV Tobacco necrosis virus A

Tobacco necrosis virus A isolate Velence, complete genome.

ACC No: GQ221829

Dated: 2010-06-10 | Length: 3682 | CRC: -95770309

                
ID   GQ221829; SV 1; linear; genomic RNA; STD; VRL; 3682 BP.
XX
AC   GQ221829;
XX
DT   19-MAY-2010 (Rel. 104, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 2)
XX
DE   Tobacco necrosis virus A isolate Velence, complete genome.
XX
KW   .
XX
OS   Tobacco necrosis virus A
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Necrovirus.
XX
RN   [1]
RP   1-3682
RX   PUBMED; 20364277.
RA   Krizbai L., Nemeth M., Law V., Reed C., Varga A., Hangyal R., James D.;
RT   "Molecular characterization of a Hungarian isolate of Tobacco necrosis
RT   virus A";
RL   Arch. Virol. 155(6):999-1001(2010).
XX
RN   [2]
RP   1-3682
RA   Krizbai L., Nemeth M., Law V., Reed C., Varga A., Hangyal R., James D.;
RT   ;
RL   Submitted (28-MAY-2009) to the EMBL/GenBank/DDBJ databases.
RL   Tree Fruit Research, Sidney Lab, Centre for Plant Health, Canadian Food
RL   Inspection Agency, 8801 East Saanich Road, Sidney, BC V8L 1H3, Canada
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3682
FT                   /organism="Tobacco necrosis virus A"
FT                   /host="Chenopodium quinoa"
FT                   /strain="A"
FT                   /isolate="Velence"
FT                   /mol_type="genomic RNA"
FT                   /country="Hungary"
FT                   /isolation_source="greenhouse conditions"
FT                   /db_xref="taxon:12055"
FT   5'UTR           1. .59
FT   CDS             60. .2234
FT                   /codon_start=1
FT                   /transl_except=(pos:666. .668,aa:OTHER)
FT                   /product="RNA-dependent RNA polymerase"
FT                   /note="RdRP"
FT                   /protein_id="ADE10194.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQTDLALI
FT                   EDTEHLDDINECFEESAGAQSQRTKVVAEGAYAPAKSNRTRRVRKQKKHKFVKYLVNEA
FT                   RAEFGLPKPTEANRLMVQHFLLRVCKDWGVVTAHVHGNVALALPLVFIPTEDDLLSRAL
FT                   MNTHATRAAVRGMEHTQGEGWWNNRLGIGGQVGLAFRSKXGCLERRPGFSTSVSRGEHP
FT                   DLVVIPSGRPEKQRQLLRYSGIGGHLLIGIHNNSLSNLRRGLMERVFFVEGPSGLQDAP
FT                   KPVKGAFRTLDKFRDLYTKNSWRHTPVTSEQFLMNYSGRKLTIYREAVDSLSHQPLSSR
FT                   DAKLKTFVKAEKLNLSKKPDPAPRVIQPRSPRYNVCLGRYLRHYEHHAFKTIAKCFGEI
FT                   TVFKGFTLEQQGEIMRSKWNKYVNPVAVGLDASRFDQHVSVEALKYEHEFYLRDYPNDK
FT                   QLKWLLKQQLCNVGTAFASDGIIKYKKEGCRMSGDMNTSLGNCILMCAMVYGLKEHLGI
FT                   QLSLANNGDDCVIVCEKADLIKLTSSIEPYFKQFGFKMEVEKPVDIFERIEFCQTQPVF
FT                   DGNQYIMVRKPSVVTSKDVTSLIPCQNQAQYAEWLQAVGECGLSINGGIPVMQNFYQML
FT                   QTGVSRTRFTKTGEFQTNGLGYHSRFMNRVARSPSPETRLSFYLAFGITPDLQEALEIF
FT                   YDTTKLELDDVIPTDTCRVSGEHLINGLSN"
FT   CDS             60. .668
FT                   /codon_start=1
FT                   /product="truncated RNA-dependent RNA polymerase"
FT                   /note="truncated RdRp"
FT                   /protein_id="ADE10193.1"
FT                   /translation="MELPNQHKQTAAEGFVSFLNWLCNPWRRQRTVNAAVAFQTDLALI
FT                   EDTEHLDDINECFEESAGAQSQRTKVVAEGAYAPAKSNRTRRVRKQKKHKFVKYLVNEA
FT                   RAEFGLPKPTEANRLMVQHFLLRVCKDWGVVTAHVHGNVALALPLVFIPTEDDLLSRAL
FT                   MNTHATRAAVRGMEHTQGEGWWNNRLGIGGQVGLAFRSK"
FT   CDS             2218. .2436
FT                   /codon_start=1
FT                   /product="p23"
FT                   /protein_id="ADE10195.1"
FT                   /translation="MDYQTDVSEDNVQVRGRARSSEGKKHNGSGLTGVKRHAVSETAQK
FT                   SQQGTGNGTMTNIAEEQTITVTYNFNF"
FT   CDS             2439. .2609
FT                   /codon_start=1
FT                   /product="p6"
FT                   /protein_id="ADE10196.1"
FT                   /translation="MAYCRCCDTSPGITLFPYFAILILILSILVVGTPNQQYHHSPSTY
FT                   EYKTQHISIAK"
FT   CDS             2612. .3442
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ADE10197.1"
FT                   /translation="MAGKKNNNNGQYIVLRTPEQQVEIDQRDARRLARGRMKKMRQPVQ
FT                   RYINGHGLQNGLSGRGGYVVAPTSGGVVTRPIVPRFSNRGDSTIVRNTEILNNQILAAA
FT                   GAFNTTNSALIAAAPSWLAGISDLYSKYRWLSCELIYIPKCPTTTSGSVVMAFTYDRNN
FT                   AAPTTRAQLSQSNKAINFPPYAGYDGAAYLNSSRGAGTAIAIQLDITKLDKPWYPTISS
FT                   GAFAALGVLDQNQFCPASLVVASDGGPVAATPAGDVFIKYVIEFIEPINPTMNV"
FT   3'UTR           3645. .3682
XX
SQ   Sequence 3682 BP; 1002 A; 848 C; 927 G; 905 T; 0 other;

gq221829 Length: 3682  10-JUN-2010  Type: N  Check: 6068  ..

       1  agtattcata ccaagaatac cgaataggtg caaagcctta ctcagccaaa
      51  gagtttaaaa tggagttacc taaccaacac aagcaaacag ccgccgaggg
     101  tttcgtttct ttcctaaact ggctatgcaa cccatggcgc cgacaacgta
     151  cagtcaacgc tgctgttgcg tttcaaaccg atttagccct cattgaggac
     201  acagagcatc tcgatgacat taacgagtgc tttgaagaat cggccggagc
     251  tcaatcacag cgcactaagg ttgtggcaga aggtgcatat gcccccgcta
     301  aatccaacag aacccgccgg gtccgcaagc agaagaagca caagtttgtc
     351  aaatatcttg tgaatgaggc ccgagccgag tttgggttgc ctaaaccaac
     401  tgaggcaaac agactcatgg ttcaacactt cctgctcagg gtgtgtaagg
     451  actggggtgt tgttactgct cacgtacacg gtaatgttgc acttgcattg
     501  cctctggtgt tcattccaac ggaagacgat ctgctgtcaa gagcattgat
     551  gaacacgcat gctacaagag ccgctgtacg aggcatggaa cacactcagg
     601  gagaagggtg gtggaacaat aggttgggga ttgggggcca ggtaggactg
     651  gccttccggt ccaaataggg gtgccttgaa aggaggccag gattctccac
     701  gtccgtttcg cgtggggagc atcctgatct ggtggtcata ccatcagggc
     751  gccctgagaa acagcgtcag ttgttacgct atagtggtat aggcggccat
     801  ttattaatcg gcatccacaa caactctctc tccaacttac gtaggggtct
     851  gatggagaga gtatttttcg tcgagggacc ttctggtctt caagacgccc
     901  ctaagcccgt caagggtgca ttccgaaccc ttgataaatt tcgtgatctc
     951  tataccaaaa atagttggcg tcatacccct gtaactagtg agcaattcct
    1001  aatgaattac tcgggcagga agctgactat ttaccgagaa gcagttgata
    1051  gtttgtcgca tcagccgctc agctccaggg atgcgaaatt gaaaacattc
    1101  gttaaggccg aaaaacttaa cctttctaag aagcctgatc ctgctcctag
    1151  ggtcatccaa cctagatcgc ctcggtacaa cgtttgtttg ggcaggtacc
    1201  tccgacatta tgaacatcat gcgttcaaaa ccattgctaa atgctttggg
    1251  gaaatcacgg tctttaaagg gtttactctc gagcaacaag gcgaaatcat
    1301  gcggtctaag tggaacaaat atgttaatcc cgttgcggtc ggactcgatg
    1351  ccagtcggtt tgaccaacac gtgtcagttg aagcacttaa gtacgagcat
    1401  gaattttatc tgagagacta cccgaatgat aaacagctaa aatggttgtt
    1451  aaaacaacaa ctgtgcaatg tcggtacggc atttgctagt gatggcatca
    1501  taaagtacaa gaaggaaggt tgcagaatga gtggggacat gaacactagt
    1551  ttgggcaatt gcatactcat gtgcgcaatg gtctacggtt tgaaggaaca
    1601  cctgggcatc caattgtcgt tggcaaacaa cggggatgac tgcgtcattg
    1651  tctgtgagaa agcggattta attaaattga cgagcagcat cgagccgtat
    1701  ttcaagcaat ttggattcaa aatggaggtg gaaaaacccg tggacatatt
    1751  tgaaagaatt gagttttgcc aaacccaacc agtgtttgat ggcaaccagt
    1801  acataatggt aagaaagcct tccgtagtaa cttccaaaga tgtcactagt
    1851  cttattccgt gtcagaatca agcacaatat gcagaatggc tgcaagctgt
    1901  aggtgagtgt ggcttgagca ttaatggagg gattccggtc atgcagaatt
    1951  tctatcaaat gctccaaact ggcgttagcc gcacaagatt taccaagacc
    2001  ggcgagttcc agacgaatgg cttggggtac cactctagat ttatgaatag
    2051  agtggcccgg agtccttcgc ctgagacccg tttgtccttt tacttagctt
    2101  ttggtatcac accagacctc caggaagcat tggagatctt ctatgatacc
    2151  acgaagctgg aattggacga tgttatccca actgatacct gccgagtatc
    2201  aggagagcat ttaatcaatg gattatcaaa ctgatgtcag tgaggacaac
    2251  gtgcaagtac gcggtcgggc taggagtagt gagggtaaga agcacaatgg
    2301  ttcgggatta actggcgtta agcgtcacgc ggtgagtgaa acagctcaga
    2351  aatcacagca aggtactggc aacggaacaa tgaccaacat agccgaagag
    2401  cagaccatta ccgtgacata caactttaac ttttagttat ggcgtattgt
    2451  cgctgttgtg atacttcacc aggtattaca ttattccctt actttgcaat
    2501  tctcatcctc atattatcaa tactggttgt tggaactcca aaccagcaat
    2551  atcatcattc tcctagtact tacgagtata agactcaaca tatttcgatc
    2601  gcaaaataga catggcagga aagaagaaca acaacaacgg tcagtacatc
    2651  gtactgcgta ctcctgagca acaggtggaa attgatcagc gtgatgctcg
    2701  cagactggca cggggccgca tgaagaaaat gaggcagccg gttcaacgat
    2751  acatcaatgg gcatgggcta cagaatggat tgtcagggcg tggtggttat
    2801  gtcgttgcac ccacatctgg tggtgtggtg actcgaccca tcgtgcctag
    2851  gttttcgaac cgaggcgact cgactattgt acgcaatacc gagatcctga
    2901  acaatcaaat attagcagca gctggcgcgt tcaacactac taattccgca
    2951  ctgattgcag cggcaccgtc atggttggct ggcatttcag atttgtacag
    3001  caaatacaga tggctatctt gtgagctcat ctacatacct aaatgtccaa
    3051  ccacaacaag tggatctgtt gtaatggctt tcacatatga tcgcaataac
    3101  gctgccccca caactagggc gcagttgtca cagtccaata aagccatcaa
    3151  ctttccaccc tatgcagggt atgacggagc ggcgtacttg aactcttcga
    3201  gaggtgctgg gactgccatt gccatccaat tggacatcac caaattggac
    3251  aagccttggt accctaccat ctcgtcaggt gcgtttgccg ccctgggggt
    3301  gttggatcag aaccagttct gcccagcttc cctggtggtc gctagtgatg
    3351  gaggtcccgt ggcagctacg cctgctgggg atgttttcat caagtacgtg
    3401  attgagttca ttgaaccaat caaccctaca atgaacgtct agttcttgta
    3451  ctgtaactcg gctaatgcct acggtagagt cacacgtgtg gagatggatg
    3501  ctggatcctg gaaaacaggt ttaacgggta gggggtggtg cccctaccga
    3551  cgcatcactc cagataccac acgtactcgg ctatggcagg gtctgtcgag
    3601  gtttgtgcgc catgatccac tggaaacggt ggtgaggggg gtagcacatt
    3651  tcatccagat tgaggggctt ttgccccacc cc