Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate Kpg2 coat protein gene, complete cds.

ACC No: GQ228821

Dated: 2010-06-10 | Length: 672 | CRC: -2074273296

                
ID   GQ228821; SV 1; linear; genomic RNA; STD; VRL; 672 BP.
XX
AC   GQ228821;
XX
DT   14-JUL-2009 (Rel. 101, Created)
DT   10-JUN-2010 (Rel. 105, Last updated, Version 3)
XX
DE   Citrus tristeza virus isolate Kpg2 coat protein gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-672
RX   PUBMED; 20437063.
RA   Biswas K.K.;
RT   "Molecular characterization of Citrus tristeza virus isolates from the
RT   Northeastern Himalayan region of India";
RL   Arch. Virol. 155(6):959-963(2010).
XX
RN   [2]
RP   1-672
RA   Biswas K.K., Tarafdar A., Kumari S.;
RT   ;
RL   Submitted (02-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Division of Plant Pathology, Indian Agricultural Research Institute, New
RL   Delhi, Delhi 110012, India
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .672
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantifolia"
FT                   /isolate="Kpg2"
FT                   /mol_type="genomic RNA"
FT                   /country="India:Darjeeling hills of West Bengal"
FT                   /collected_by="Kajal K. Biswas"
FT                   /collection_date="2006"
FT                   /identified_by="Kajal K. Biswas"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .672
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /note="CP"
FT                   /db_xref="GOA:C7DZB8"
FT                   /db_xref="InterPro:IPR002679"
FT                   /db_xref="UniProtKB/TrEMBL:C7DZB8"
FT                   /protein_id="ACT31578.1"
FT                   /translation="MDDETKKLKNKNKETKEGDDVVAAESSFGSLNLHIDTTLIAMNDV
FT                   RQLGTQQNAALNRDLFLTLKGKHPNLPDKDKDFHLAMMLCRLAVKSSSLQSDDDTTGIT
FT                   YTREGVEVDLPDKLWTDVVFNSKGIGNRTNALRVWGRTNDALYLAFCRQNSNLSYGGRP
FT                   LDAGIPAGYHYLCADFLTGAGLTDLECAVYIQAKEQLLKKRGADEVVVTNVRQLGKFNT
FT                   R"
XX
SQ   Sequence 672 BP; 199 A; 125 C; 166 G; 182 T; 0 other;

gq228821 Length: 672  10-JUN-2010  Type: N  Check: 1793  ..

       1  atggacgacg aaacaaagaa attgaagaac aaaaacaagg aaacgaaaga
      51  aggcgacgat gttgttgccg ctgagtcttc tttcggttcc ttaaacttac
     101  acatcgatac aactctgata gcgatgaatg acgtgcgtca gttgggtacc
     151  caacagaacg ctgctttaaa cagagactta tttcttactt tgaaagggaa
     201  gcatcctaac ttacctgaca aagataagga ctttcactta gctatgatgt
     251  tgtgtcgttt agcagttaag agttcatcat tacaaagcga tgacgatact
     301  acgggtataa cgtacactcg ggagggtgtt gaagtggatt tgcctgacaa
     351  actttggact gacgtcgtgt ttaactccaa gggtattggc aaccgtacta
     401  acgcccttcg agtttggggt agaactaacg atgcccttta cttagctttt
     451  tgtagacaaa atagcaattt gagttatggc ggacgtccgc tagatgcagg
     501  gattccggcc gggtatcatt acctgtgtgc agatttcttg accggagctg
     551  gcttgactga tttagaatgt gctgtgtaca tacaagctaa agaacaattg
     601  ttgaagaagc gaggagctga tgaagttgta gttaccaatg tcaggcagct
     651  tgggaaattt aacacacgtt ga