Sequence of DPV Calibrachoa mottle virus

Calibrachoa mottle virus isolate California, complete genome.

ACC No: GQ244431

Dated: 2010-02-02 | Length: 3919 | CRC: -531082294

                
ID   GQ244431; SV 1; linear; genomic RNA; STD; VRL; 3919 BP.
XX
AC   GQ244431;
XX
DT   20-JUL-2009 (Rel. 101, Created)
DT   02-FEB-2010 (Rel. 103, Last updated, Version 2)
XX
DE   Calibrachoa mottle virus isolate California, complete genome.
XX
KW   .
XX
OS   Calibrachoa mottle virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Carmovirus.
XX
RN   [1]
RP   1-3919
RA   Gulati-Sakhuja A., Liu H.-Y.;
RT   "Complete nucleotide sequence and genome organization of Calibrachoa mottle
RT   virus (CbMV)-A new species in the genus Carmovirus of the family
RT   Tombusviridae";
RL   Virus Res. 147(2):216-223(2010).
XX
RN   [2]
RP   1-3919
RA   Gulati-Sakhuja A., Liu H.-Y.;
RT   ;
RL   Submitted (04-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   USDA-ARS, 1636 E. Alisal St., Salinas, CA 93905, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .3919
FT                   /organism="Calibrachoa mottle virus"
FT                   /host="Calibrachoa sp."
FT                   /isolate="California"
FT                   /mol_type="genomic RNA"
FT                   /country="USA"
FT                   /collection_date="Jan-2002"
FT                   /db_xref="taxon:204928"
FT   5'UTR           1. .36
FT   gene            37. .2325
FT                   /gene="P87"
FT   CDS             37. .2325
FT                   /codon_start=1
FT                   /transl_except=(pos:775. .777,aa:OTHER)
FT                   /gene="P87"
FT                   /product="P87"
FT                   /note="RNA-dependent RNA polymerase; readthrough stop
FT                   codon"
FT                   /db_xref="GOA:C7E3L1"
FT                   /db_xref="InterPro:IPR002166"
FT                   /db_xref="InterPro:IPR007094"
FT                   /db_xref="UniProtKB/TrEMBL:C7E3L1"
FT                   /protein_id="ACT36594.1"
FT                   /translation="MGILQLAKELTVGGVCCTTLLCVGVAALEVRLALGAYEFNKQCIS
FT                   NVRGFIESRGQSHPSEPKYAKAEVSPFQAELDDDLEDDAEMRNYLEKHEDKEKDDEGKV
FT                   VVKNVRTTLPRNRHTKGKFLKRLVADTKNHFGGTPTPTDANRLAVMKYMVGRCREHHMV
FT                   DLHIRQVTELAKAAVFTPDILEVQSVQLLNSYPAYRRRCALHKAHQVQVWKELLTNCFH
FT                   KDAWEYIWFRMNGGLARSPFQFHKXGGITFLEGVCTKIARGAHPYLKEKVIPRAPKLRK
FT                   LYLQQSCTSGLQYRVHNNSIANLRRGLLERVFYVENKDTKKLQTCPEPEAGIFKELKTI
FT                   RQQFVRLCGHHTRISTEQFVDCYQGRKRTIYQKAADSLSEIAIDRSDSRLKTFVKAEKF
FT                   CIDLKPDPAPRVIQPRMPRYNVELGRYLKKVEHSAYRALDKIWGGRTVMKGYTVEEVGM
FT                   IISDAWDQFHMPVAVGFDMSRFDQHVSVPALQFEHTCYMSLFPGDRHLQQLLSWQLRNY
FT                   GVGVASNGILRYKVDGKRMSGDMNTALGNCILACLITKHLFPGNYRLINNGDDCVLITE
FT                   RNNLPEITSKLEAGWRRFGFTCISEKPVFVKEEIEFCQMQPVYDGQTYVMVRKPYISMS
FT                   KDAFSLTPWPNEKACQQWLGAVGMCGERLCGKIPILQSYYQAYCRANKGRKPKMDAHEK
FT                   GGMYMLAMNSKRAFGEISQDCRFSFYKAFGITPDQQVAIESLIDCHEISTEPGPPESWS
FT                   ANIPLLIKQ"
FT   gene            37. .777
FT                   /gene="P28"
FT   CDS             37. .777
FT                   /codon_start=1
FT                   /gene="P28"
FT                   /product="P28"
FT                   /note="replication-related protein"
FT                   /db_xref="UniProtKB/TrEMBL:C7E3L2"
FT                   /protein_id="ACT36595.1"
FT                   /translation="MGILQLAKELTVGGVCCTTLLCVGVAALEVRLALGAYEFNKQCIS
FT                   NVRGFIESRGQSHPSEPKYAKAEVSPFQAELDDDLEDDAEMRNYLEKHEDKEKDDEGKV
FT                   VVKNVRTTLPRNRHTKGKFLKRLVADTKNHFGGTPTPTDANRLAVMKYMVGRCREHHMV
FT                   DLHIRQVTELAKAAVFTPDILEVQSVQLLNSYPAYRRRCALHKAHQVQVWKELLTNCFH
FT                   KDAWEYIWFRMNGGLARSPFQFHK"
FT   gene            2289. .2498
FT                   /gene="P8"
FT   CDS             2289. .2498
FT                   /codon_start=1
FT                   /gene="P8"
FT                   /product="P8"
FT                   /db_xref="GOA:C7E3L3"
FT                   /db_xref="InterPro:IPR007982"
FT                   /db_xref="UniProtKB/TrEMBL:C7E3L3"
FT                   /protein_id="ACT36596.1"
FT                   /translation="MEREHPTINKAISTKEKSKQLNSSKDKNKLSGKLTAAKAVANEQA
FT                   RGSVYGGSFTNVAREIKMEIHFHF"
FT   gene            2413. .2664
FT                   /gene="P9"
FT   CDS             2413. .2664
FT                   /codon_start=1
FT                   /gene="P9"
FT                   /product="P9"
FT                   /db_xref="UniProtKB/TrEMBL:C7E3L4"
FT                   /protein_id="ACT36597.1"
FT                   /translation="MNKHVVVFTGVVSLMLLGRLRWRSISIFDFFPPVNIPNINQSIAL
FT                   ALCGLILNCIGKAEPSYSYYSTHDSSKTQYIKINTPDG"
FT   gene            2657. .3685
FT                   /gene="P37"
FT   CDS             2657. .3685
FT                   /codon_start=1
FT                   /gene="P37"
FT                   /product="coat protein"
FT                   /db_xref="GOA:C7E3L5"
FT                   /db_xref="InterPro:IPR000937"
FT                   /db_xref="UniProtKB/TrEMBL:C7E3L5"
FT                   /protein_id="ACT36598.1"
FT                   /translation="MDNYKNSPVITTLANKGVPWAIKFKTKTWQALTPNQKKLAREALG
FT                   MNLTATVIIPKRARGSPAVAKPNRLGPGTAGKTSTCTGSELLLTLPKQTGYTPLTKSWI
FT                   LNPGQYSPFRRASLMSSMYNKYMFTNIKVRWTTTASFESSGRIVLAYNSDSSDPVPTKA
FT                   GIVEFKTRAENVVTTSFILDIPGDGKYRYCRDSTSNDPKLVDFGRLIVMHYGAAESDSA
FT                   YLGEVLVDYTVVFSEPIPTGSITQQGEQLVSDGPGYAFVTVQPTTFRLTIYGEGKWLVV
FT                   WQSSTATPDVNIKGDGAKAHITSSADSKTVIAVVTAELEGAYLESTTLAAVSGLKWYVS
FT                   RL"
FT   3'UTR           3686. .3919
XX
SQ   Sequence 3919 BP; 1187 A; 844 C; 949 G; 939 T; 0 other;

gq244431 Length: 3919  02-FEB-2010  Type: N  Check: 9145  ..

       1  cgataaactt agctttatct cggtgattga gcaatcatgg gtatactaca
      51  attggcaaaa gaactaaccg taggaggagt gtgttgcaca actctactat
     101  gcgttggggt ggcagccctg gaagtacgcc tagctttagg agcatacgag
     151  tttaacaagc aatgtatcag caacgttaga ggttttatag aatcaagggg
     201  acagtcacac ccttcagaac ccaagtatgc taaagctgaa gtgtcacctt
     251  tccaagctga attggatgac gatctggaag atgacgcaga aatgcgaaac
     301  tatctggaaa aacatgaaga caaggaaaag gatgacgagg gcaaagtggt
     351  ggtgaaaaat gtgcgaacaa ccttacctag aaataggcat accaaaggaa
     401  aattcttgaa aaggttagtc gccgacacta aaaaccactt tggcggaacc
     451  cccaccccca ctgatgctaa tagactagct gtgatgaaat acatggtggg
     501  aaggtgtcga gaacatcata tggtagactt gcacattcgg caggtcactg
     551  aactggcaaa agcagcagtg ttcactccag acattctaga agtgcaaagt
     601  gtgcaattgc tcaactctta tccagcctac cggcggcggt gcgctctcca
     651  caaagcgcat caagtgcagg tgtggaaaga gttgctgact aattgcttcc
     701  ataaggatgc ctgggagtat atttggttcc ggatgaatgg gggattggct
     751  cgatcccctt ttcagttcca taaatagggg ggtataacct ttctcgaggg
     801  tgtgtgtaca aaaatagcca ggggggcaca cccttacctc aaagagaaag
     851  ttatacctcg agcccccaaa cttaggaaac tttacctcca acaatcctgc
     901  acctccggtt tgcagtaccg ggtgcataat aacagcatcg ccaatttacg
     951  cagaggatta ctggagcggg ttttctacgt ggaaaataaa gatacaaaaa
    1001  aactgcagac ttgtccagag ccagaagccg gtatttttaa agagcttaaa
    1051  acgatcagac agcaatttgt aaggttatgc ggtcatcata cccggatctc
    1101  cacagagcaa tttgtggatt gttatcaggg caggaaacgc acaatctacc
    1151  aaaaagctgc agactcattg agcgaaatag ccatagaccg gtctgactca
    1201  cgtctaaaga cttttgtgaa ggcagagaag ttttgtattg atctcaaacc
    1251  agatccggcc cccagagtga tccaacctag aatgcccaga tataacgtag
    1301  agctgggaag atacctaaag aaggtggaac actctgctta tcgcgcctta
    1351  gataaaattt ggggtggcag gacggtgatg aaagggtata ctgtcgaaga
    1401  agttggtatg ataatcagtg atgcctggga ccaattccac atgccagttg
    1451  ctgttggatt tgacatgagt cgattcgacc aacacgtaag tgtgccagca
    1501  ttacagttcg aacacacctg ctacatgtct ctatttccag gagacaggca
    1551  cctgcaacaa ctactgtcat ggcaattacg aaattatgga gtcggggtag
    1601  caagcaatgg catccttagg tacaaagtag atggcaagag aatgagtggt
    1651  gacatgaata cagctttggg taattgcatc ttggcatgtt tgataaccaa
    1701  acatttgttt ccgggtaatt acaggctcat caacaatggt gacgattgtg
    1751  ttctcataac agagcgcaac aacctccccg agattacttc caagctggag
    1801  gcagggtgga ggagatttgg attcacctgc atttctgaga agcctgtttt
    1851  tgtcaaagag gaaatagaat tttgccaaat gcaacctgtc tatgatggtc
    1901  aaacttatgt catggtccgt aagccctata tctctatgtc taaggatgct
    1951  tttagtttaa ccccgtggcc aaacgaaaaa gcatgtcagc agtggttggg
    2001  tgcagtaggt atgtgtggag agagactgtg cggaaagata ccaatcttgc
    2051  agtcttatta tcaagcatat tgcagagcta acaaagggcg aaagccaaaa
    2101  atggatgcgc acgagaaggg gggtatgtac atgctagcta tgaattcgaa
    2151  gcgggctttt ggggagattt cccaggattg taggttttca ttctataaag
    2201  cttttggtat tacacctgac caacaggttg ccatcgaaag cttgatagat
    2251  tgccatgaaa tctccacgga acccggcccg cctgaatcat ggagcgcgaa
    2301  catcccacta ttaataaagc aataagcacc aaggaaaaga gtaaacagct
    2351  gaacagttca aaggataaaa ataaactgag tggcaagtta actgcagcta
    2401  aagctgtagc taatgaacaa gcacgtggta gtgtttacgg gggtagtttc
    2451  actaatgttg ctagggagat taagatggag atccatttcc atttttgact
    2501  tctttccccc agtgaatatc cctaacataa accaatcgat agcacttgca
    2551  ctctgtggat taatcctaaa ctgtatagga aaggcagaac cctcatacag
    2601  ctattattct acacacgaca gcagtaaaac ccaatacatc aagatcaata
    2651  cacctgatgg ataactacaa gaactcacct gtcatcacta ccttagctaa
    2701  caagggtgtt ccatgggcga tcaagtttaa aactaaaact tggcaggcgt
    2751  taacgccaaa ccaaaagaag cttgctcgtg aggcgttagg catgaaccta
    2801  actgccaccg tgataatacc caagagagct cgaggtagcc cagctgtagc
    2851  caagccgaat aggcttggcc ctggtacggc tggcaaaacg tctacctgca
    2901  caggatcaga actactccta actttgccca agcagactgg ttacacgcca
    2951  cttactaaat catggatatt gaatccaggt caatacagcc ccttccgccg
    3001  agcgtcatta atgtccagca tgtacaacaa gtatatgttt acaaacataa
    3051  aggtgcggtg gaccactaca gcctctttcg aatcatcagg aagaattgtc
    3101  ctggcttaca acagtgatag ttcagacccg gtgcctacta aagctggaat
    3151  agtggagttt aaaacaaggg cggagaacgt ggtgaccaca agctttatat
    3201  tggacattcc aggagatgga aaatatagat actgcagaga ctcgacaagt
    3251  aacgacccca aactagtgga cttcggaaga cttatcgtaa tgcactatgg
    3301  ggccgcggaa tcagactcag cttacttggg agaggtttta gttgactaca
    3351  ccgtcgtgtt ttctgaacca attcctaccg ggtcgatcac gcaacaaggc
    3401  gaacagctcg tctcagatgg tccaggatat gcctttgtca ctgtacaacc
    3451  gactactttt cgcctcacga tatacggaga gggtaaatgg ctggtagttt
    3501  ggcagtcgag tactgccact cccgatgtaa atatcaaggg agacggtgcc
    3551  aaggcacaca tcacatcatc tgctgacagt aagacggtta tagctgtggt
    3601  tacagctgaa ttagaagggg cttacttgga aagtactact ttagctgctg
    3651  tatcagggct taagtggtac gtttctcggt tatgaacact aagagttact
    3701  gccaccaaaa gaggataatc agaccacttg tagtttgctg ccacaaactg
    3751  gttgacaagt taatgcctct ctcttagtta gtaagccgga ttcaagtagg
    3801  gaatgtggag ggagatgcca tggtggcatc agagcagacc tggaaatact
    3851  cttcggaggg gcgccagaac tgcactaaac acttgttatc aggggactgt
    3901  tgaggagtct ccccgcccg