Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus isolate Gyp1 replication-associated protein 2, replication-associated protein 1, coat protein, movement protein, and silencing suppressor genes, complete cds.

ACC No: GQ259476

Dated: 2009-10-14 | Length: 4612 | CRC: 503470034

                
ID   GQ259476; SV 1; linear; genomic RNA; STD; VRL; 4612 BP.
XX
AC   GQ259476;
XX
DT   14-OCT-2009 (Rel. 102, Created)
DT   14-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Carnation Italian ringspot virus isolate Gyp1 replication-associated
DE   protein 2, replication-associated protein 1, coat protein, movement
DE   protein, and silencing suppressor genes, complete cds.
XX
KW   .
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4612
RX   PUBMED; 19768632.
RA   Koenig R., Lesemann D.E., Pfeilstetter E.;
RT   "New isolates of carnation Italian ringspot virus differ from the original
RT   one by having replication-associated proteins with a typical
RT   tombusvirus-like N-terminus and by inducing peroxisome- rather than
RT   mitochondrion-derived multivesicular bodies";
RL   Arch. Virol. 154(10):1695-1698(2009).
XX
RN   [2]
RP   1-4612
RA   Koenig R.;
RT   ;
RL   Submitted (11-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Epidemiologie und Pathogendiagnostik, Julius Kuehn Institut,
RL   Bundesforschungsinstitut fuer Kulturpflanzen, Messeweg 11, Braunschweig
RL   D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4612
FT                   /organism="Carnation Italian ringspot virus"
FT                   /host="Gypsophila paniculata"
FT                   /isolate="Gyp1"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:39443"
FT   CDS             142. .2598
FT                   /codon_start=1
FT                   /transl_except=(pos:1030. .1032,aa:OTHER)
FT                   /product="replication-associated protein 2"
FT                   /note="P1-RT; readthrough of stop codon"
FT                   /protein_id="ACX53271.1"
FT                   /translation="METIKRMIWPKKEIFVGEFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFR
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYDGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQFEHSFYRAMYPGNKLLGKLLDWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQKTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVEKFYSRFTLYDVPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             142. .1032
FT                   /codon_start=1
FT                   /product="replication-associated protein 1"
FT                   /note="P1"
FT                   /protein_id="ACX53270.1"
FT                   /translation="METIKRMIWPKKEIFVGEFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFR
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             2610. .3770
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACX53272.1"
FT                   /translation="MTMVLRNPGTMVPQGGNKMSKMAKNAFQQGLQAGAAYLVSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDLEPADRVELANYATLKETAPWAEAMLRIPTDRIKRYNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISYSVTLHFPQPTAAGVQTRRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLFGAVRSTGSPVIGLSSANIAINSNTTLNTA
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTNNADLI"
FT   CDS             3805. .4374
FT                   /codon_start=1
FT                   /product="movement protein"
FT                   /protein_id="ACX53273.1"
FT                   /translation="MDTEYEQVNKPWNELYKETKLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3837. .4355
FT                   /codon_start=1
FT                   /product="silencing suppressor"
FT                   /protein_id="ACX53274.1"
FT                   /translation="MERAIQGNQAREQANGERWDGGSGGTTSPFKLPDESPSWAEWRLH
FT                   NDEKNSNQDNPLGFKESWGFGKVVFKRYLRYDRTETSLHRVLGSWTGDSVNYAASRFFG
FT                   VNQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   TEAFEEESE"
XX
SQ   Sequence 4612 BP; 1229 A; 951 C; 1259 G; 1173 T; 0 other;

gq259476 Length: 4612  14-OCT-2009  Type: N  Check: 7646  ..

       1  agttcgtttg tctggtgact tgcgctaacc gttgctttgc gtagggaatt
      51  tctctccacg actactatct ttagttttgg ggtttgaagg ttgggtctac
     101  ctttcggggg gataaattgt aacttccaac aaataagcga catggagacc
     151  atcaagagaa tgatctggcc taagaaggag attttcgtag gagaattcgc
     201  gaccggagtt aataggacgg caccggtgga catcttccag ttggtgtgtc
     251  gtgtggttct aagatacatg aggacaggga aaatagagtg tgattcagac
     301  agcatgacta agtttatagt tgaattacta aagactgatt gtgctgctaa
     351  atgggagtgg tttatgaaga gacggcagag gggtgactat gttgtccctc
     401  tatctatagc cgccatccca atcataccgc tgttgagtta tgccactagg
     451  gtacgcgcag tctcagtcaa agctttcggc aatgaacttt cgttcaatgt
     501  ccgagtgcct agaccatctg tacctaagaa gggcttactc ctcagactgg
     551  cggcaggtct agcgttagca cctatatgcg cgctggcagt gtacgctacc
     601  ctacccaggg aaaaactgtc ggtatttagg ctaagaaccg aggcacgtgc
     651  acacatggag gatgagaggg aagcgactga ttgtttggtg gttgagccgg
     701  cacgggaact taagggtaag gatggtgagg atctcctcac tggtagtagg
     751  ttgactaagg tgattgcgtc cacgggacgc cctcgtagaa ggccttatgc
     801  ggctaaaatc gctcaggtcg cgagagctaa ggtgggttac ctcaagaata
     851  gtcctgagaa tagactgatc taccagcgag tgatgattga gatcatggac
     901  aaagactgcg tcaggtacgt tgacagggat gtcatattgc ctttggctat
     951  tggatgctgt tttgtctatc cggacggagt ggaggagtcg gcggcactat
    1001  ggggttccca ggaatccctt ggtgtcaaat agggaggcct agtacgtcta
    1051  cctggggttg tgacacagat caatcgagat atcccatctg atgtgttact
    1101  tccccaggag gtgctagagg ttcgtacagg acctcccaat gctaaggacc
    1151  gtaatatatt tatggttgca ggttgcccat cacaggcacg gttcttagta
    1201  cataatcact gcctgaaaaa ccttaaaagg ggtcttgtgg agagagtctt
    1251  ctgcgtagag agaaacggga agctcgctcg cactccacaa cctaccaaag
    1301  gagcctttgg acgtctttcc ccgttcagga aagcagtttg tgagaaggtc
    1351  ggagtagccc atcgacttgg gtatgatgga tttctgtcat actacgacgg
    1401  tgcgaaactc cgtacttaca cacgagctgt ggagagtctg catatcacac
    1451  ctgtctcgga gagggatagt catctgacta ccttcgtcaa ggcagagaag
    1501  atatcgacgt ctaaaggtga cccagcacct agggtgattc agcctcgaaa
    1551  ccctaggtac aatgtcgaac ttggaagata tctacggcat atggaatcca
    1601  agctgatgaa agctgttgat ggcgtgttcg gagagacgac gtgcatcaaa
    1651  ggatatacag ccgacgaggt gggtgcaatt tttcgagaga agtgggacag
    1701  gtttgataaa cccgtagcca taggtctcga tgcatccagg tttgatcaac
    1751  actgttccgt tgaagccttg cagtttgagc atagcttcta cagggccatg
    1801  taccctggca acaagctttt gggcaagttg ttggactggc aactccacaa
    1851  taaagggaaa ggttatgttc ctgatggaac tataacatat cgcaaggagg
    1901  ggtgccgtat gagtggggat ataaacactt cgttggggaa ctatctattg
    1951  atgtgcgcta tggtacacgg gtacatgcgc catttgggga ttaatgagtt
    2001  tagtctggca aactgtgggg atgactgtgt tcttatacta gaacgtagga
    2051  atcttaaaca ggtacagaag actctgcctg agtatttcct taacctggga
    2101  tatactatga aggtggagcc gcctgtattt caattggaag aggttgaatt
    2151  ttgccaggca caccccgtac agtttcaagg tggttggaag atggtccgta
    2201  atgtccgtac cgcaatgagc aaagatgtgc attgtgtcaa taacatacgc
    2251  gatttggcga cgaggagagc gtggagtaat gcccaacacc atggtggatt
    2301  agcacttagt gctggtatac ctgtggttga gaagttttac tccaggttca
    2351  cattgtatga tgtacctcgc aaacatcaac gtattgacac tgtcactaat
    2401  gttcataagt ggcgcggatc tggcggaagt tatgttgtga ctcctgaatc
    2451  tagggctagc ttttgggctg cctttggctt gacgggggat gagcaactgg
    2501  ctttggagga tcgtctggat agatgggaga tggatctatt tggagaggag
    2551  ggtgttgacg ctcatgagcc cagcattctc gactccgccg tagcttgacc
    2601  aagcaagaca tgacaatggt actaagaaat ccaggcacaa tggtgcctca
    2651  aggcggcaac aaaatgagta agatggcgaa gaatgcattt caacaaggat
    2701  tacaagcggg ggcagcttat ttagtgagca accccaaggg ggcattaaag
    2751  aaagggaaag acgcatggaa ttacatgaca gcagggggtg tgccaagtgg
    2801  tatagtacac tcagggggaa tgaaaggcgc gataatggcg cccgtggcag
    2851  ttaccagaca gttaaggggg agtaaaccta aattctccgg aagaacatct
    2901  ggttccgtga cagtgagtca tagagagcta attacgcaag tgaacaactc
    2951  aacgcagttt gtggttaatg gtggtgttac tggtaacctt aggcaagtta
    3001  atcccttgaa tgggaccttg ttctcatggc tgcctagcat tgccgctaac
    3051  tttgatcagt acacatttaa tagtgttacg ttgcattacg tacctttatg
    3101  tgctactacc gaaactgggc gggttgcaat gtattttgac aaagattccg
    3151  aggacctcga gcccgcggac agagtagagc ttgctaatta tgctacattg
    3201  aaagaaactg caccatgggc cgaggctatg ttacgtatac ctactgatcg
    3251  catcaaacgg tataacgatg acagcagcgt aaatgatcgc aaattgattg
    3301  acctgggaca gataggtatt gcaacatatg gtggttcggg cacaaaccct
    3351  gtcggggacg tgttcatatc ttacagtgtt actctacact tcccacaacc
    3401  tactgcagcc ggtgtgcaga cacggcgtct tgatctcaca agtgttttag
    3451  acacaaatgt cggacctagt tacactatca cgtccagtac ggctacggta
    3501  tacacggttg ctttccgcac cgtgggtacc tttatgctgt ttggcgccgt
    3551  gaggtctact gggtcacccg ttatcggact gtctagtgca aatattgcta
    3601  ttaatagcaa caccacattg aacacagccg gtactgcttt ctcctacatg
    3651  acgaatgtca cagtgtcggc tttaccggcg tctatcacat tcactgtagt
    3701  tggagtaatt acttcgtcaa cttcacatgc cgtgagagca tcccgtacta
    3751  ataacgcaga cctgatatag taccattgag gggcctcttg aacaagacca
    3801  gttcatggat actgaatacg aacaagtcaa taaaccatgg aacgagctat
    3851  acaaggaaac caagctaggg aacaagctaa tggtgaacgt tgggatggag
    3901  gatcaggagg taccacttct cccttcaaac ttcctgacga aagtccgagt
    3951  tgggctgagt ggcggctaca taacgatgag aagaattcga atcaagataa
    4001  tccccttggt ttcaaggaaa gctggggttt cgggaaagtt gtatttaaga
    4051  gatatctcag atacgacagg acggaaactt cattgcacag agtccttgga
    4101  tcttggacgg gagattcggt taactatgca gcatctcgat ttttcggtgt
    4151  caaccagatc ggatgtacct atagtattcg gtttcgagga gttagtgtca
    4201  ccatttctgg agggtcgaga actcttcagc atctctgtga gatggcaatt
    4251  cggtctaagc aagaactgtt acagcttacc ccagtcgaag tggaaagtaa
    4301  tgtatcaaga ggatgccctg aaggcactga agccttcgaa gaagaaagcg
    4351  agtaagacag actcttcagt ctgagttcgc tgaaacgagt gtaaatctgg
    4401  catagcatac aggttactct tgttgggttc tagatgttat gatgacgagt
    4451  cggtcgggct ccgcactagg tttggtcgcc taggggatgg agatatggaa
    4501  agggtctcgt gtgctgttag acggtcgtaa gacgcgcttg caacatgggc
    4551  ctataaccgg ataagtcata gcaatactag ccaacatgaa ttggttagat
    4601  tcaagaagcc ca