Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus isolate K483 replication-associated protein 2, replication-associated protein 1, coat protein, movement protein, and silencing suppressor genes, complete cds.

ACC No: GQ259477

Dated: 2009-10-14 | Length: 4612 | CRC: 217902601

                
ID   GQ259477; SV 1; linear; genomic RNA; STD; VRL; 4612 BP.
XX
AC   GQ259477;
XX
DT   14-OCT-2009 (Rel. 102, Created)
DT   14-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Carnation Italian ringspot virus isolate K483 replication-associated
DE   protein 2, replication-associated protein 1, coat protein, movement
DE   protein, and silencing suppressor genes, complete cds.
XX
KW   .
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4612
RX   PUBMED; 19768632.
RA   Koenig R., Lesemann D.E., Pfeilstetter E.;
RT   "New isolates of carnation Italian ringspot virus differ from the original
RT   one by having replication-associated proteins with a typical
RT   tombusvirus-like N-terminus and by inducing peroxisome- rather than
RT   mitochondrion-derived multivesicular bodies";
RL   Arch. Virol. 154(10):1695-1698(2009).
XX
RN   [2]
RP   1-4612
RA   Koenig R.;
RT   ;
RL   Submitted (11-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Epidemiologie und Pathogendiagnostik, Julius Kuehn Institut,
RL   Bundesforschungsinstitut fuer Kulturpflanzen, Messeweg 11, Braunschweig
RL   D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4612
FT                   /organism="Carnation Italian ringspot virus"
FT                   /isolate="K483"
FT                   /mol_type="genomic RNA"
FT                   /isolation_source="surface water sample"
FT                   /db_xref="taxon:39443"
FT   CDS             142. .2598
FT                   /codon_start=1
FT                   /transl_except=(pos:1030. .1032,aa:OTHER)
FT                   /product="replication-associated protein 2"
FT                   /note="P1-RT; readthrough of stop codon"
FT                   /protein_id="ACX53276.1"
FT                   /translation="METIRRMIWPKKEIFVGEFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATKV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRAGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYNGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQFEHSFYRAMYPGNKLLGKLLDWQLHNKGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQKTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVEKFYSRFTLYDVPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             142. .1032
FT                   /codon_start=1
FT                   /product="replication-associated protein 1"
FT                   /note="P1"
FT                   /protein_id="ACX53275.1"
FT                   /translation="METIRRMIWPKKEIFVGEFAIGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFVVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATKV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             2610. .3770
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACX53277.1"
FT                   /translation="MTMVLRNPGTMVPQGGNKMSKMAKNAFQQGLQAGAAYLMSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDLEPADRVELANYATLKETAPWAEAMLRIPTDRIKRYNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISYSVTLHFPQPTAAGVQTRRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLFGAVRSTGSPVIGLSSANIAINSNTTLNTA
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTDNADLI"
FT   CDS             3805. .4374
FT                   /codon_start=1
FT                   /product="movement protein"
FT                   /protein_id="ACX53278.1"
FT                   /translation="MDTEYEQVNKPWNELYKETKLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3837. .4355
FT                   /codon_start=1
FT                   /product="silencing suppressor"
FT                   /protein_id="ACX53279.1"
FT                   /translation="MERAIQGNEAREQANGERWDGGSGSTTSPFKLPDESPSWTEWRLY
FT                   NDETNSNQDYPLGFKESWGFGKVVFKRYLRYDRTETSLHRVLGSWTGDSVNYAASRFFG
FT                   VNQIGCTYSIRFRGVSVTISGGSRTLQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   TEAFKEESE"
XX
SQ   Sequence 4612 BP; 1236 A; 942 C; 1253 G; 1181 T; 0 other;

gq259477 Length: 4612  14-OCT-2009  Type: N  Check: 7791  ..

       1  agttcgttta tctggtgact tgcgctaact gttgctttgc gtagggaatt
      51  tctctccacg actactatct ttagttttgg ggtttgaagg ttgggtctac
     101  ctttcggggg gataaattgt aacttccaac aaacaagcga catggagacc
     151  atcaggagaa tgatctggcc taagaaggag attttcgtag gagaattcgc
     201  gatcggagtt aataggacgg caccggtgga catcttccag ttggtgtgtc
     251  gtgtggttct aagatacatg aggacaggga aaatagagtg tgattccgac
     301  agtatgacta agtttgtagt tgaattacta aaaactgatt gtgctgccaa
     351  atgggagtgg tttatgaaga gacggcagag gggtgactat gttgtccctc
     401  tatctatagc cgccatccca atcataccgc tattgagtta tgccactaag
     451  gtacgcgcag tctcagtcaa ggcttttggc aatgaactct cgttcaatgt
     501  tagggtgcct agaccatctg taccaaagaa gggcttactc cttagactgg
     551  cggcaggcct agcgttagca cctatatgcg cgctggcagt gtacgctacc
     601  ctccctaggg aaaaactgtc tgtatttaag ctaagaaccg aggcacgcgc
     651  acacatggaa gatgagaggg aagcgactga ttgtttggtg gttgagccgg
     701  cacgggaact taagggtaag gatggtgagg atctcctcac tggtagtaga
     751  ttgactaagg tgattgcgtc cacggggcgc cctcgcagac ggccttatgc
     801  agctaaaatt gcacaggtcg cgagagctaa ggtgggttac cttaagaata
     851  gtcctgaaaa cagacttatc taccagcgag tgatgattga gatcatggac
     901  aaggactgcg tcaggtatgt tgacagggat gtcatattgc ctttggctat
     951  tggatgctgt tttgtctatc cggacggagt ggaggagtcg gcggcactat
    1001  ggggttctca ggaatccctt ggtgtcaaat agggaggcct agtacgtcta
    1051  cctggggttg taacacagat caatcgagat atcccatctg atgtgttact
    1101  tcctcaggag gtgctagagg ttcgtgcagg acctcccaat gctaaggacc
    1151  gtaatatatt tatggttgca ggttgcccat cacaggcacg gttcttagta
    1201  cataatcact gcctgaaaaa ccttaaaagg ggtcttgtgg agagagtctt
    1251  ctgcgtagag agaaacggaa agctcgctcg cactccacaa cctaccaaag
    1301  gagcctttgg acgtctttcc ccgttcagga aagcagtttg tgagaaggtt
    1351  ggagttgccc accgacttgg gtatgatggg ttcctatcat actacaacgg
    1401  tgcgaagctc cgtacttaca cacgagctgt ggagagtctg catatcactc
    1451  ctgtctcgga gagggatagt catctgacta ccttcgtcaa ggcggagaag
    1501  atatcgacgt caaagggtga cccagcacct agggtgattc agcctcgaaa
    1551  ccctaggtac aatgtcgaac ttggaagata tctacggcat atggaatcca
    1601  agctgatgaa agctgttgat ggcgtgttcg gagaaacgac gtgcatcaag
    1651  ggatatacag ccgacgaggt gggtgcaatt tttcgagaga agtgggatag
    1701  gtttgataaa cccgtcgcca ttggcctcga tgcatccagg tttgatcaac
    1751  actgttccgt tgaagcattg cagtttgagc atagtttcta cagggccatg
    1801  taccctggca acaagctttt gggcaagttg ttggactggc aactccataa
    1851  caaagggaaa ggttatgttc ctgatggaac cataacatac cgcaaggagg
    1901  ggtgccgcat gagtggggat ataaacactt cgttgggaaa ctatctattg
    1951  atgtgcgcta tggtacacgg gtacatgcgc catttgggga ttaatgagtt
    2001  tagtctggca aactgtgggg acgactgtgt tcttatacta gaacgtagga
    2051  atcttaagca ggtgcagaaa actctaccag agtatttcct taatctagga
    2101  tataccatga aggtggagcc gcctgtattt caattggaag aggttgaatt
    2151  ttgccaggca caccccgtac agtttcaagg tggttggaag atggtccgca
    2201  atgtccgcac cgcaatgagc aaagatgtgc attgtgtcaa taatatacgc
    2251  gatctggcaa cgaggagagc atggagcaac gcccaacacc atggtggatt
    2301  ggcacttagt gctggtatac ctgtggttga gaagttttac tccagattta
    2351  cattgtatga tgtacctcgg aaacaccaac gtattgacac tgtcactaat
    2401  gttcataagt ggcgtggatc tggtggaagt tatgttgtga ctcctgaatc
    2451  cagggctagc ttttgggctg cctttggttt gacgggggat gagcaactgg
    2501  ctttggagga tcgtctggat agatgggaga tggatctatt tggagaggag
    2551  ggtgttgacg ctcacgagcc cagcatcctt gactccgccg tagcttgacc
    2601  aagcaagaca tgacaatggt actgagaaat ccaggcacaa tggtgcctca
    2651  aggcggcaat aagatgagta agatggcgaa gaatgcattt caacaaggat
    2701  tacaagcagg ggctgcttat ctgatgagca accccaaggg ggcattaaag
    2751  aaagggaaag acgcatggaa ttacatgaca gcagggggtg tgccaagtgg
    2801  tatagtgcac tcagggggaa tgaaaggcgc gataatggcg cccgtggcag
    2851  ttaccagaca gttaaggggg agtaaaccta aattctccgg aagaacatct
    2901  ggttccgtga cagtaagtca tagagagcta attacgcaag tgaacaactc
    2951  aacgcagttt gtggttaatg gtggtgttac aggcaatctt aggcaagtta
    3001  atcccttgaa tgggaccttg ttttcatggt tacctagcat tgccgctaac
    3051  tttgatcagt acacatttaa tagtgttacg ttacattacg tacctttatg
    3101  tgctacgacc gaaactgggc gagttgcaat gtattttgac aaagattcgg
    3151  aggaccttga gcctgcggac agagtagagc ttgctaacta tgctacattg
    3201  aaggaaactg caccatgggc cgaggctatg ttacgtatac ctactgatcg
    3251  tatcaaacgg tataatgatg acagcagcgt aaatgatcgc aaattgattg
    3301  acctgggaca aataggtata gcaacatatg gtggttcggg cacaaaccct
    3351  gttggggatg tgttcatatc ttacagtgtt actttacact tcccacaacc
    3401  tactgcagcc ggtgtgcaga cacggcgtct tgatctcaca agtgttttag
    3451  acacaaatgt cggacctagt tacaccataa cgtccagtac agctacggta
    3501  tacacagttg cttttcgcac tgttggcacc ttcatgctgt ttggtgccgt
    3551  gaggtcaact gggtcacccg ttatcggact gtctagtgca aatattgcta
    3601  ttaatagcaa caccacattg aacacagccg gtactgcttt ctcctacatg
    3651  acgaatgtca cggtgtcggc tctgccggca tccattacat tcactgtagt
    3701  tggagtgatt acttcgtcaa cttcgcatgc cgtgagagca tcccgtactg
    3751  ataacgcaga cctgatctag taccattgag gggcctcttg aacaagacca
    3801  gttcatggat actgaatacg aacaagtcaa taaaccatgg aacgagctat
    3851  acaaggaaac gaagctaggg aacaagctaa tggtgaacgt tgggatggag
    3901  gatcaggaag taccacttct cccttcaaac ttcctgacga aagtccgagt
    3951  tggactgagt ggcggctata taacgatgag acgaattcga atcaagatta
    4001  tccccttggt ttcaaggaaa gctggggttt cgggaaagtt gtatttaaga
    4051  gatatctcag atacgacagg acggaaactt cattgcacag agtccttgga
    4101  tcttggacgg gagattcggt taactatgca gcatctcgat ttttcggtgt
    4151  caaccagatc ggatgtacct atagtattcg gtttcgagga gttagtgtca
    4201  ccatttctgg agggtcgaga actcttcagc atctctgtga gatggcaatt
    4251  cggtctaagc aagaattgtt acagcttacc ccagtcgaag tggaaagtaa
    4301  tgtatcaaga ggatgccctg aaggcactga agccttcaaa gaagaaagcg
    4351  agtaagacag actcttcagt ctgagtttgc ggaaatgagt gtaaatctgg
    4401  catagcatac aggttactct tgttgggttc tagatgttat gatgacgagc
    4451  tggtcgggct ccgcactagg tttggtcgcc taggggatgg agatatggaa
    4501  agggtctcgt gtgctgttag tcggtcggaa gacgcgcttg caacatgggc
    4551  ctataaccgg ataagtcata gcaatactag ccaacatgaa ttggttagat
    4601  tcaagaagcc ca