Sequence of DPV Carnation Italian ringspot virus

Carnation Italian ringspot virus isolate OE14 replication-associated protein 2, replication-associated protein 1, coat protein, movement protein, and silencing suppressor genes, complete cds.

ACC No: GQ259479

Dated: 2009-10-14 | Length: 4612 | CRC: -508331376

                
ID   GQ259479; SV 1; linear; genomic RNA; STD; VRL; 4612 BP.
XX
AC   GQ259479;
XX
DT   14-OCT-2009 (Rel. 102, Created)
DT   14-OCT-2009 (Rel. 102, Last updated, Version 1)
XX
DE   Carnation Italian ringspot virus isolate OE14 replication-associated
DE   protein 2, replication-associated protein 1, coat protein, movement
DE   protein, and silencing suppressor genes, complete cds.
XX
KW   .
XX
OS   Carnation Italian ringspot virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Tombusviridae;
OC   Tombusvirus.
XX
RN   [1]
RP   1-4612
RX   PUBMED; 19768632.
RA   Koenig R., Lesemann D.E., Pfeilstetter E.;
RT   "New isolates of carnation Italian ringspot virus differ from the original
RT   one by having replication-associated proteins with a typical
RT   tombusvirus-like N-terminus and by inducing peroxisome- rather than
RT   mitochondrion-derived multivesicular bodies";
RL   Arch. Virol. 154(10):1695-1698(2009).
XX
RN   [2]
RP   1-4612
RA   Koenig R.;
RT   ;
RL   Submitted (11-JUN-2009) to the EMBL/GenBank/DDBJ databases.
RL   Institut fuer Epidemiologie und Pathogendiagnostik, Julius Kuehn Institut,
RL   Bundesforschungsinstitut fuer Kulturpflanzen, Messeweg 11, Braunschweig
RL   D38104, Germany
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .4612
FT                   /organism="Carnation Italian ringspot virus"
FT                   /host="sweet cherry tree"
FT                   /isolate="OE14"
FT                   /mol_type="genomic RNA"
FT                   /db_xref="taxon:39443"
FT   CDS             142. .2598
FT                   /codon_start=1
FT                   /transl_except=(pos:1030. .1032,aa:OTHER)
FT                   /product="replication-associated protein 2"
FT                   /note="P1-RT; readthrough of stop codon"
FT                   /protein_id="ACX53286.1"
FT                   /translation="METIKRLIWPKKEIFVGEFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVKXGGLVRLPGVVTQINRDIPSDVLLPQEVLEVRTGPPNAKDRNIF
FT                   MVAGCPSQARFLVHNHCLKNLKRGLVERVFCVERNGKLARTPQPTKGAFGRLSPFRKAV
FT                   CEKVGVAHRLGYDGFLSYYNGAKLRTYTRAVESLHITPVSERDSHLTTFVKAEKISTSK
FT                   GDPAPRVIQPRNPRYNVELGRYLRHMESKLMKAVDGVFGETTCIKGYTADEVGAIFREK
FT                   WDRFDKPVAIGLDASRFDQHCSVEALQFEHSFYRAMYPGNKLLGKLLDWQLHNRGKGYV
FT                   PDGTITYRKEGCRMSGDINTSLGNYLLMCAMVHGYMRHLGINEFSLANCGDDCVLILER
FT                   RNLKQVQKTLPEYFLNLGYTMKVEPPVFQLEEVEFCQAHPVQFQGGWKMVRNVRTAMSK
FT                   DVHCVNNIRDLATRRAWSNAQHHGGLALSAGIPVVEKFYSRFTLYDVPRKHQRIDTVTN
FT                   VHKWRGSGGSYVVTPESRASFWAAFGLTGDEQLALEDRLDRWEMDLFGEEGVDAHEPSI
FT                   LDSAVA"
FT   CDS             142. .1032
FT                   /codon_start=1
FT                   /product="replication-associated protein 1"
FT                   /note="P1"
FT                   /protein_id="ACX53285.1"
FT                   /translation="METIKRLIWPKKEIFVGEFATGVNRTAPVDIFQLVCRVVLRYMRT
FT                   GKIECDSDSMTKFIVELLKTDCAAKWEWFMKRRQRGDYVVPLSIAAIPIIPLLSYATRV
FT                   RAVSVKAFGNELSFNVRVPRPSVPKKGLLLRLAAGLALAPICALAVYATLPREKLSVFK
FT                   LRTEARAHMEDEREATDCLVVEPARELKGKDGEDLLTGSRLTKVIASTGRPRRRPYAAK
FT                   IAQVARAKVGYLKNSPENRLIYQRVMIEIMDKDCVRYVDRDVILPLAIGCCFVYPDGVE
FT                   ESAALWGSQESLGVK"
FT   CDS             2610. .3770
FT                   /codon_start=1
FT                   /product="coat protein"
FT                   /protein_id="ACX53287.1"
FT                   /translation="MTMVLRNPGTMVPQGGNKMSKMAKNAFQQGLQAGAAYLMSNPKGA
FT                   LKKGKDAWNYMTAGGVPSGIVHSGGMKGAIMAPVAVTRQLRGSKPKFSGRTSGSVTVSH
FT                   RELITQVNNSTQFVVNGGVTGNLRQVNPLNGTLFSWLPSIAANFDQYTFNSVTLHYVPL
FT                   CATTETGRVAMYFDKDSEDLEPADRVELANYATLKETAPWAEAMLRIPTDRIKRYNDDS
FT                   SVNDRKLIDLGQIGIATYGGSGTNPVGDVFISYSVTLHFPQPTAAGVQTQRLDLTSVLD
FT                   TNVGPSYTITSSTATVYTVAFRTVGTFMLFGAVRSTGSPVIGLSSANIAINSNTTLNTA
FT                   GTAFSYMTNVTVSALPASITFTVVGVITSSTSHAVRASRTNNADLI"
FT   CDS             3805. .4374
FT                   /codon_start=1
FT                   /product="movement protein"
FT                   /protein_id="ACX53288.1"
FT                   /translation="MDTEYEQVNKPWNELYKETTLGNKLMVNVGMEDQEVPLLPSNFLT
FT                   KVRVGLSGGYITMRRIRIKIIPLVSRKAGVSGKLYLRDISDTTGRKLHCTESLDLGREI
FT                   RLTMQHLDFSVSTRSDVPIVFGFEELVSPFLEGRELFSISVRWQFGLSKNCYSLPQSKW
FT                   KVMYQEDALKALKPSKKKASKTDSSV"
FT   CDS             3837. .4355
FT                   /codon_start=1
FT                   /product="silencing suppressor"
FT                   /protein_id="ACX53289.1"
FT                   /translation="MERAIQGNDAREQANGERWDGGSGGTTSPFKLPDESPSWTEWRLH
FT                   NDETNSNQDNPLGFKESWGFGKVVFKRYLRYDRTETSLHRVLGSWTGNSVNYAASRFFG
FT                   VNQIGCTYSIRFRGVSVTISGGSRALQHLCEMAIRSKQELLQLTPVEVESNVSRGCPEG
FT                   AEAFEEESE"
XX
SQ   Sequence 4612 BP; 1234 A; 944 C; 1255 G; 1179 T; 0 other;

gq259479 Length: 4612  14-OCT-2009  Type: N  Check: 1264  ..

       1  agttcgttta tctggtgact tgcgctaatc gttgctttgc gtagggaatt
      51  tctctccacg actactatct ttagttttgg ggtttgaagg ttgggtctac
     101  ctttcggggg gataaattgt aactgccaac aaataagcga catggagacc
     151  atcaagagac tgatctggcc taagaaggag attttcgtag gagaattcgc
     201  gaccggggtt aataggacgg caccggtgga catcttccaa ttggtgtgtc
     251  gtgtggttct aagatacatg aggacaggga aaatagagtg tgattctgac
     301  agcatgacta agtttatagt tgaattacta aaaactgatt gtgctgccaa
     351  gtgggagtgg ttcatgaaga gacggcagag gggtgactat gttgtccctc
     401  tatctatagc tgctatccca atcataccgc tactgagtta tgccactagg
     451  gtacgcgcag tctcagtcaa ggcttttggc aatgagcttt cgttcaatgt
     501  cagagtgcct agaccatctg tacctaagaa gggtttactc cttagactgg
     551  cggcaggcct agcgttagca cctatatgcg cgctggcagt gtacgctacc
     601  ctacccaggg aaaaactgtc ggtatttaag ctgaggaccg aagcacgcgc
     651  acacatggag gatgagagag aagcgactga ttgtttggtg gttgagccgg
     701  cacgggaact taagggtaag gatggtgagg atctcctcac tggtagtaga
     751  ttaactaagg tgattgcgtc cacggggcgc cctcgcagaa ggccttatgc
     801  agctaaaatt gcacaggtcg cgagagctaa ggtgggttac cttaagaata
     851  gtcctgagaa tagactaatc taccagcgag tgatgattga gatcatggac
     901  aaagactgcg ttaggtatgt tgacagggat gtcatattgc ctttggctat
     951  tggatgctgt tttgtctatc cggacggagt ggaggagtcg gcggcactat
    1001  ggggttctca ggaatccctt ggtgtcaaat agggaggcct agtacgtcta
    1051  cctggggttg taacacagat caatcgagat atcccatctg atgtgttact
    1101  tccccaggag gtgctagagg ttcgtacagg acctcccaat gctaaggacc
    1151  gtaatatatt tatggttgca ggttgcccat cacaggcacg gttcttagta
    1201  cataatcatt gcctgaaaaa ccttaaaagg ggtcttgtgg agagagtctt
    1251  ctgcgtagag agaaacggga agctcgctcg cactccacaa cctaccaaag
    1301  gagcttttgg acgtctttcc ccgttcagga aagcagtttg tgagaaggtt
    1351  ggagttgccc accgacttgg gtatgatgga tttctgtcat actacaacgg
    1401  tgcgaagctc cgtacttaca cacgagctgt ggagagtctg catatcactc
    1451  ctgtctcgga gagggatagt catctgacta ccttcgtcaa ggcagagaag
    1501  atatcgacgt ctaaaggtga cccagcacct agggtgattc agcctcgaaa
    1551  ccctaggtac aatgtcgaac ttggaagata tctacggcat atggaatcca
    1601  agctgatgaa agctgttgat ggcgtgtttg gagaaacgac gtgcatcaag
    1651  ggatatacag ccgacgaggt gggtgcaatc tttcgagaga agtgggatag
    1701  gtttgataaa cctgttgcca ttggtctcga tgcatccagg tttgatcaac
    1751  actgttccgt ggaggctttg caattcgagc atagcttcta cagggccatg
    1801  taccctggca ataagctcct gggcaagttg ttggactggc aactccataa
    1851  tagagggaaa ggttatgttc ctgatggaac tataacatac cgtaaggagg
    1901  ggtgccgcat gagtggggat ataaacactt cgttaggtaa ttatctattg
    1951  atgtgcgcaa tggtacacgg gtacatgcgc catttgggga ttaatgagtt
    2001  tagtctggca aactgtgggg atgattgtgt tcttatattg gaacgcagga
    2051  atcttaagca ggtacaaaag actctaccag agtatttcct taatctagga
    2101  tatactatga aggtggagcc gcctgtattt caattggaag aggttgaatt
    2151  ttgccaggca caccccgtac agtttcaagg tggttggaag atggtccgca
    2201  atgtccgtac cgcaatgagc aaggacgtgc actgtgttaa caatatacgc
    2251  gatttggcga cgaggagagc atggagtaat gcccaacacc atggtggatt
    2301  agcacttagt gctggcatac ctgtggttga gaagttttac tccaggttta
    2351  cattatatga tgtacctcgc aaacatcaac gtattgacac agtcaccaac
    2401  gttcataagt ggcgtggatc tggtggaagt tatgttgtga cccctgaatc
    2451  tagggctagc ttttgggctg cctttggttt gacgggggat gagcaactgg
    2501  ctttggagga tcgtctggat agatgggaga tggatctatt tggagaggag
    2551  ggtgttgacg ctcacgagcc cagcattctc gactccgccg tagcttgacc
    2601  aagcaagaca tgacaatggt actaagaaat ccaggcacaa tggtgcctca
    2651  aggcggcaac aaaatgagta agatggcgaa gaatgcattt cagcaaggat
    2701  tacaagcagg ggctgcttat ctgatgagca accccaaggg ggcattaaag
    2751  aaagggaaag acgcatggaa ttacatgaca gcagggggtg taccaagtgg
    2801  tatagtacac tcagggggaa tgaaaggcgc gataatggcg cccgtggcag
    2851  ttaccagaca gttaaggggg agtaagccta aattctccgg aagaacatct
    2901  ggttccgtga cagtaagtca tagagagcta attacgcaag tgaacaactc
    2951  aacgcagttt gtggttaatg gtggtgttac tggtaacctt agacaagtta
    3001  atcccttgaa tgggaccttg ttctcatggc tgcctagcat tgccgctaac
    3051  tttgatcagt acacatttaa tagtgttacg ttgcattacg tacctttatg
    3101  tgctactacc gagactgggc gagttgcaat gtattttgac aaagattccg
    3151  aggaccttga gcccgcggac agagtagagc ttgctaatta cgctacattg
    3201  aaagaaactg caccatgggc cgaggctatg ttacgtatac ctactgatcg
    3251  catcaaacgg tataacgatg acagcagcgt aaatgatcgc aaattgattg
    3301  acctgggaca aataggtatt gcaacatatg gtggttcggg cacaaaccct
    3351  gtcggggatg tgttcatatc ttacagtgtt actctacact tcccacaacc
    3401  cactgcagcc ggtgtgcaga cacagcgtct tgatctcaca agtgttttag
    3451  acacaaatgt cggacctagt tacactatca catccagtac ggccacggtg
    3501  tacacagtcg cttttcgcac tgtgggcact tttatgctgt ttggagctgt
    3551  gaggtctact gggtcacccg ttatcggact gtccagtgca aacattgcta
    3601  ttaatagcaa caccacgttg aacacagccg gtactgcttt ctcctacatg
    3651  acgaacgtga cggtgtcggc tttgccagca tccatcacgt tcactgtggt
    3701  tggagtgatt acttcgtcaa cttcacatgc cgtgagagca tcccgtacta
    3751  ataacgcaga cctgatatag taccattgag gggcctcttg aacaagacca
    3801  gttcatggat actgaatacg aacaagtcaa taaaccatgg aacgagctat
    3851  acaaggaaac gacgctaggg aacaagctaa tggtgaacgt tgggatggag
    3901  gatcaggagg taccacttct cccttcaaac ttcctgacga aagtccgagt
    3951  tggactgagt ggcggctaca taacgatgag acgaattcga atcaagataa
    4001  tccccttggt ttcaaggaaa gctggggttt cgggaaagtt gtatttaaga
    4051  gatatctcag atacgacagg acggaaactt cattgcacag agtccttgga
    4101  tcttggacgg gaaattcggt taactatgca gcatctcgat ttttcggtgt
    4151  caaccagatc ggatgtacct atagtattcg gtttcgagga gttagtgtca
    4201  ccatttctgg agggtcgaga gctcttcagc atctctgtga gatggcaatt
    4251  cggtctaagc aagaactgtt acagcttacc ccagtcgaag tggaaagtaa
    4301  tgtatcaaga ggatgccctg aaggcgctga agccttcgaa gaagaaagcg
    4351  agtaagacag actcttcagt ctgagtttgc ggaaatgagt gtaaatctgg
    4401  catagcatac aggttactct tgttgggttc tagatgttat gatgacgagt
    4451  cggacggact ccgcactagg tttggtcgcc taggggatgg aggtatggaa
    4501  agggtctcgt gtgctgttag tcggtcgaaa gacgcgcttg caacatgggc
    4551  ctatatccgg ataagtcata gcaatactag ccaacatgaa ttggttagat
    4601  tcaagaagcc ca