Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT-W1 p13 gene, complete cds.

ACC No: GQ338615

Dated: 2012-01-02 | Length: 360 | CRC: -1866760078

                
ID   GQ338615; SV 1; linear; genomic RNA; STD; VRL; 360 BP.
XX
AC   GQ338615;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT-W1 p13 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .360
FT                   /organism="Citrus tristeza virus"
FT                   /host="Poncirus trifoliata"
FT                   /isolate="CT-W1"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .360
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="ADH95327.1"
FT                   /translation="MSIRRVWLKIMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYDLANFDLDFLRIVIIPLSGGAVNESRADRTNVSEIVESHMSDRDRMSILL
FT                   RNKRIQIPSLLPCDN"
XX
SQ   Sequence 360 BP; 97 A; 66 C; 80 G; 117 T; 0 other;

gq338615 Length: 360  02-JAN-2012  Type: N  Check: 7816  ..

       1  atgagcattc gacgcgtgtg gttaaagatt atggctgtaa ttacggtatt
      51  atggtacggt aaagaacctt ccattagtga aggttacaat gctcttatga
     101  atgatgactt taaatttatc gatacgcact tttcaaacgt ttcttatgct
     151  aagaaatgtt acgatttggc taatttcgat ttagactttc tacgcatcgt
     201  tatcattcct ttgagtggtg gtgcggtgaa tgaatcgcgt gctgatcgca
     251  ctaacgtctc agagattgtc gaatcgcata tgagcgaccg agacagaatg
     301  agcatcttgt tgcgtaataa gcggatccaa attccttcgc tcttaccttg
     351  cgataactag