Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT-W6 p13 gene, complete cds.

ACC No: GQ338620

Dated: 2012-01-02 | Length: 360 | CRC: 1117274566

                
ID   GQ338620; SV 1; linear; genomic RNA; STD; VRL; 360 BP.
XX
AC   GQ338620;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT-W6 p13 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .360
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus ichangensis"
FT                   /isolate="CT-W6"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .360
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="ADH95332.1"
FT                   /translation="MSIRRVWLKVVAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGTANESRADRTNISEIVESHVSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
XX
SQ   Sequence 360 BP; 93 A; 65 C; 86 G; 116 T; 0 other;

gq338620 Length: 360  02-JAN-2012  Type: N  Check: 6327  ..

       1  atgagtattc gacgcgtgtg gttaaaggtt gtggccgtga ttacggtatt
      51  gtggtacggt aaagagcctt cgattagtga aggttacaat gctcttatga
     101  atgacgactt taagtttatc gatacgcatt tttcaaacgt ttcttatgct
     151  aagaaatgtt acgaattggc taatttcgat ttagactttc tacgcatcgt
     201  tatcattccc ttgagtggtg gtacggcgaa tgaatcgcgt gctgatcgca
     251  ctaacatttc agagattgtc gaatcgcatg tgagcgaccg agacagaatg
     301  aatatcttgt tgcgtaataa gcggatccag attccttcgc tcttaccttg
     351  cgataactag