Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT21 p13 gene, complete cds.

ACC No: GQ338629

Dated: 2012-01-02 | Length: 360 | CRC: 384922678

                
ID   GQ338629; SV 1; linear; genomic RNA; STD; VRL; 360 BP.
XX
AC   GQ338629;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT21 p13 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-360
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .360
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus sinensis"
FT                   /isolate="CT21"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .360
FT                   /codon_start=1
FT                   /product="p13"
FT                   /protein_id="ADH95341.1"
FT                   /translation="MSIRRVWLKVMAVITVLWYGKEPSISEGYNALMNDDFKFIDTHFS
FT                   NVSYAKKCYELANFDLDFLRIVIIPLSGGAVNESRADRTNVSEIVESHMSDRDRMNILL
FT                   RNKRIQIPSLLPCDN"
XX
SQ   Sequence 360 BP; 94 A; 65 C; 84 G; 117 T; 0 other;

gq338629 Length: 360  02-JAN-2012  Type: N  Check: 7831  ..

       1  atgagtattc gacgcgtgtg gttaaaggtt atggctgtaa ttacggtatt
      51  gtggtacggt aaagaacctt ccattagtga aggttacaat gctcttatga
     101  atgatgactt taagtttatc gatacgcatt tttcaaacgt ttcttatgct
     151  aagaaatgtt acgagttggc taatttcgat ttagactttc tacgcatcgt
     201  catcattccc ttgagtggtg gtgcggtgaa tgaatcgcgt gctgatcgca
     251  ctaacgtttc agagattgtc gaatcgcata tgagcgaccg agacagaatg
     301  aacatcttgt tgcgtaataa gcggatccag attccttcgc tcttaccttg
     351  cgataactag