Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT-W3 p20 gene, complete cds.

ACC No: GQ338632

Dated: 2012-01-02 | Length: 549 | CRC: -1629598229

                
ID   GQ338632; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   GQ338632;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT-W3 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Poncirus trifoliata"
FT                   /isolate="CT-W3"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ADH95344.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 137 A; 115 C; 138 G; 159 T; 0 other;

gq338632 Length: 549  02-JAN-2012  Type: N  Check: 1757  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgtt tgtgcgatcc cagcgtaact ctcacggaag
     101  tgatggacga aattaatgat tttaactcgt ttctcgcttt ggtacactct
     151  atgaagtcag acatgaacgg cgatcatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcgattgt tgtgcaacat agaggcgaaa ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag atgtcatggg cttcttcgtt atgaggtaca tgagttctag
     351  tcacaccagt ttcgagtccg taatgcgaac ggagctgaaa ttagtggtta
     401  aagcggtact gtcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatcctttta caaaagggta ctgtagcgac
     501  cgtttgcggt cagtttgaca ttaatttagt ttctccatct tgcgtgtag