Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT-W8 p20 gene, complete cds.

ACC No: GQ338637

Dated: 2012-01-02 | Length: 549 | CRC: 37017671

                
ID   GQ338637; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   GQ338637;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT-W8 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus ichangensis"
FT                   /isolate="CT-W8"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ADH95349.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPGVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRILLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMASSHISFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVATVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 139 A; 113 C; 135 G; 162 T; 0 other;

gq338637 Length: 549  02-JAN-2012  Type: N  Check: 4033  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  cggcgcagtt gtggaacgct tgtgcgatcc cggcgtgact ctcacggaag
     101  tgatggacga aattaacgat tttaactcgt ttctcgcttt agtacactct
     151  atgaagtcag acatgaacgg tgatcatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcgattgt tgtgcaatat agaggcgaaa ctgcgaatac
     251  ttctcgacat cataagacgt cggtttactc gcgacaagct gctctgtacc
     301  agcgcaacag acgtcatggg cttcttcgtt atgaggtaca tggcttctag
     351  tcacatcagt tttgaatccg taatgcgaac ggagctgaaa ttagtagtta
     401  aagcagtact atcggattta tcccgcgcgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatcctttta caaaagggta ctgtagcgac
     501  tgtttgcggt cagtttgata ttaatttagt ttctccatct tgcgtgtag