Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT-W9 p20 gene, complete cds.

ACC No: GQ338638

Dated: 2012-01-02 | Length: 549 | CRC: -1102728712

                
ID   GQ338638; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   GQ338638;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT-W9 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus aurantium"
FT                   /isolate="CT-W9"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ADH95350.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLTEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTREKLLCTSATD
FT                   VMGFFVVRYMSSSHTSFESVMHTELKLVVKAVLSDLSRTHKLDFSERAFAAYGILLQKG
FT                   AVATVCSQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 133 A; 116 C; 142 G; 158 T; 0 other;

gq338638 Length: 549  02-JAN-2012  Type: N  Check: 4076  ..

       1  atgcgagctt actttagtgt taacgattac ataagccttt tggctaaggt
      51  tggcgcagtt gtggaacgtt tatgcgatcc cagcgtaact ctcacggagg
     101  tgatggacga aattaatgac tttaactcat tcctcgcttt ggtgcactct
     151  atgaagtcgg acatgaacgg agaccatcag gatggtcacc atgagatggg
     201  tgaacacaag tctcggttgt tgtgcaatat agaggcgaaa ctgcgagtac
     251  ttctcgacat cataagacgt cggttcactc gcgaaaaact gctctgtacc
     301  agtgccacag atgtcatggg cttcttcgtc gtgaggtaca tgagttctag
     351  tcacaccagt ttcgagtccg taatgcatac ggaattgaag ttagtggtta
     401  aggcggtgct gtcagatctg tcccgcacgc ataaactaga ttttagcgag
     451  cgagcctttg cggcttacgg tatcctttta caaaagggtg ccgtggcgac
     501  cgtttgtagt cagtttgaca ttaatttagt ttctccatct tgcgtgtag