Sequence of DPV Citrus tristeza virus

Citrus tristeza virus isolate CT3 p20 gene, complete cds.

ACC No: GQ338641

Dated: 2012-01-02 | Length: 549 | CRC: 1872313540

                
ID   GQ338641; SV 1; linear; genomic RNA; STD; VRL; 549 BP.
XX
AC   GQ338641;
XX
DT   02-JAN-2012 (Rel. 111, Created)
DT   02-JAN-2012 (Rel. 111, Last updated, Version 1)
XX
DE   Citrus tristeza virus isolate CT3 p20 gene, complete cds.
XX
KW   .
XX
OS   Citrus tristeza virus
OC   Viruses; ssRNA positive-strand viruses, no DNA stage; Closteroviridae;
OC   Closterovirus.
XX
RN   [1]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   "Origin and evolution of viruses causing Citrus tristeza disease";
RL   Unpublished.
XX
RN   [2]
RP   1-549
RA   Yi L., Zhou C.Y., Zhou Y.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   Citrus Research Institute, Chinese Academy of Agricultural Science, Xiema,
RL   Beibei, Chongqing 400712, China
XX
FH   Key             Location/Qualifiers
FH
FT   source          1. .549
FT                   /organism="Citrus tristeza virus"
FT                   /host="Citrus paradisi"
FT                   /isolate="CT3"
FT                   /mol_type="genomic RNA"
FT                   /country="China"
FT                   /db_xref="taxon:12162"
FT   CDS             1. .549
FT                   /codon_start=1
FT                   /product="p20"
FT                   /protein_id="ADH95353.1"
FT                   /translation="MRAYFSVNDYISLLAKVGAVVERLCDPSVTLAEVMDEINDFNSFL
FT                   ALVHSMKSDMNGDHQDGHHEMGEHKSRLLCNIEAKLRVLLDIIRRRFTRDKLLCTSATD
FT                   VMGFFVMRYMSSSHTSFESVMRTELKLVVKAVLSDLSRAHKLDFSERAFAAYGILLQKG
FT                   TVSTVCGQFDINLVSPSCV"
XX
SQ   Sequence 549 BP; 134 A; 114 C; 144 G; 157 T; 0 other;

gq338641 Length: 549  02-JAN-2012  Type: N  Check: 4845  ..

       1  atgcgagctt actttagtgt taatgattac ataagccttt tggctaaggt
      51  cggcgcagtc gtggaacgtt tatgcgatcc cagcgtaact cttgcggaag
     101  tgatggacga aattaatgac tttaactcgt ttctcgcttt agtgcactct
     151  atgaagtcag acatgaacgg agaccatcag gatggtcacc acgagatggg
     201  tgaacacaag tctcggttgt tatgcaacat agaggcgaaa ttgagagtac
     251  ttctcgacat cataagacgt cggttcactc gcgacaagct gctctgtacc
     301  agcgcgacag atgtcatggg cttctttgta atgaggtata tgagctctag
     351  ccacaccagc ttcgaatccg taatgaggac ggagttgaag ttggtggtta
     401  aggcggtact gtcggattta tcccgcgcgc ataaactgga ttttagcgag
     451  cgagcttttg cagcttatgg tatccttttg caaaagggca ctgtgtcgac
     501  cgtttgcggt cagtttgaca ttaatttagt ctctccatct tgcgtgtag